[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37638.1
DDBJ      :             protein of unknown function UPF0102
Swiss-Prot:Y400_RHOPS   RecName: Full=UPF0102 protein RPD_0400;

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->131 3fovA PDBj 1e-25 58.4 %
:RPS:SCOP  25->118 2inbA1  c.52.1.32 * 2e-11 12.8 %
:HMM:SCOP  23->124 1hh1A_ c.52.1.18 * 2.7e-25 35.4 %
:RPS:PFM   24->68 PF02021 * UPF0102 1e-04 46.7 %
:HMM:PFM   25->114 PF02021 * UPF0102 1.3e-25 41.6 89/93  
:BLT:SWISS 1->131 Y400_RHOPS 6e-57 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37638.1 GT:GENE ABE37638.1 GT:PRODUCT protein of unknown function UPF0102 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 467172..467567 GB:FROM 467172 GB:TO 467567 GB:DIRECTION + GB:PRODUCT protein of unknown function UPF0102 GB:PROTEIN_ID ABE37638.1 GB:DB_XREF GI:91681336 InterPro:IPR003509 LENGTH 131 SQ:AASEQ MAKTRSPSTPPAPERVAAFQTGISAETRAAAFLMAKGYRILARRFKTPYGEIDIVAQRRKLIAFVEVKARARLDDAAYALTPRQQQRIIAAAEAWLVANPDHATYELRFDAMLVAPKRLPQHLPAAFDASP GT:EXON 1|1-131:0| SW:ID Y400_RHOPS SW:DE RecName: Full=UPF0102 protein RPD_0400; SW:GN OrderedLocusNames=RPD_0400; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|Y400_RHOPS|6e-57|100.0|131/131| SEG 69->80|ararlddaayal| SEG 83->92|rqqqriiaaa| BL:PDB:NREP 1 BL:PDB:REP 24->131|3fovA|1e-25|58.4|101/101| RP:PFM:NREP 1 RP:PFM:REP 24->68|PF02021|1e-04|46.7|45/93|UPF0102| HM:PFM:NREP 1 HM:PFM:REP 25->114|PF02021|1.3e-25|41.6|89/93|UPF0102| RP:SCP:NREP 1 RP:SCP:REP 25->118|2inbA1|2e-11|12.8|94/128|c.52.1.32| HM:SCP:REP 23->124|1hh1A_|2.7e-25|35.4|99/0|c.52.1.18|1/1|Restriction endonuclease-like| OP:NHOMO 59 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111111111111111111111111-111-1111----111-111111111111-1111-------------------11--111------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 77.1 SQ:SECSTR #######################cHHHHHHHHHHHTTcEEEEEEEEETTEEEEEEEEETTEEEEEEEE######EccccccHHHHHHHHHHHHHHHHHcGGGTc#EEEEEEEEEcTTcccEEEEEEEcccc DISOP:02AL 1-21,131-132| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccEEEEEEEEccEEEEEEEEcccccccHHHcccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccEEEcHHccccc //