[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37651.1
DDBJ      :             imidazole glycerol phosphate synthase subunit hisH
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  706/915 : Eukaryota  115/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:216 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->209 1ka9H PDBj 7e-27 40.3 %
:RPS:PDB   3->214 2d7jA PDBj 4e-22 18.8 %
:RPS:SCOP  3->214 1jvnA2  c.23.16.1 * 1e-42 33.2 %
:HMM:SCOP  3->205 2abwA1 c.23.16.1 * 1.1e-47 36.6 %
:RPS:PFM   66->211 PF00117 * GATase 2e-11 39.8 %
:HMM:PFM   5->212 PF00117 * GATase 3.3e-33 30.5 177/192  
:BLT:SWISS 1->216 HIS5_RHOPA e-115 89.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37651.1 GT:GENE ABE37651.1 GT:PRODUCT imidazole glycerol phosphate synthase subunit hisH GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(479255..479905) GB:FROM 479255 GB:TO 479905 GB:DIRECTION - GB:PRODUCT imidazole glycerol phosphate synthase subunit hisH GB:PROTEIN_ID ABE37651.1 GB:DB_XREF GI:91681349 InterPro:IPR000991 InterPro:IPR010139 InterPro:IPR011702 InterPro:IPR012998 LENGTH 216 SQ:AASEQ MSVAIIDYGSGNLHSAAKAFERAARSMEVPEKIIVTRDPEQVFRSDRVVLPGVGAFADCRKGLDAVDGMVEALTETVRVKARPFFGICVGMQLMATRGKEHVTTDGLNWIPGDVVKITPNQEELKIPHMGWNTLDVLREHPVLERLPLGPNGLHAYFVHSFHLAAQSEGDVLARADYGGPVTAVVGRDTAIGTQFHPEKSQRFGLALISNFLKWKP GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 1->216|HIS5_RHOPA|e-115|89.4|216/216| BL:PDB:NREP 1 BL:PDB:REP 1->209|1ka9H|7e-27|40.3|186/195| RP:PDB:NREP 1 RP:PDB:REP 3->214|2d7jA|4e-22|18.8|181/188| RP:PFM:NREP 1 RP:PFM:REP 66->211|PF00117|2e-11|39.8|123/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 5->212|PF00117|3.3e-33|30.5|177/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 3->214|1jvnA2|1e-42|33.2|199/232|c.23.16.1| HM:SCP:REP 3->205|2abwA1|1.1e-47|36.6|194/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 936 OP:NHOMOORG 876 OP:PATTERN ---1--1111111111-1111111111111111111112111111111111111-1-111-1----11 1111111111111111111-111111111111111111111111111-1111111111--111111111111111111--11111111111111-----1-111111112---------------1111111121111111111111111111111121121-1111111112111223122111111111111111111111111111111111111111111111111111-11111111111111111-1----11-2---11--11----1-111-------111------------------------1----1----11-1111111-1-111111----1-1--1111111111-11111111--1-111111-----111111211111111111111111111111111111-1111111211111111111111111111111111111111111-----------------------------1211111111111111111111111111111111111111111111111121112122111111111111111111113211111111111-111211211--1-111131111222222-1-------11111111111111111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1-----222211211111111-1111---11111111111112111111111111-1111--------111111111111113111111111111111121112211--------------------------------------1--1-111111 ------1-----11111111111121111111111111-111111111111111111111111111111111111111111-1-1111-12111111-11-21111-11------------------------------------------------------1-1-------1-1-118111111212-11111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 216 STR:RPRED 100.0 SQ:SECSTR EEEEEEEcccTTHHHHHHHHHHTTcTccTTEcEEEEETTccHHHHHTTcccEEEEcccccHTTTccTTHHHHHHTGGGTccccEEEETHHHHHHHHHTTcEEEEcTTccTTGGGcccccEEEEccccccEEEEEEEcccTTTTTTccTcccEEEEEEcccEEEEEccTTEEEEEcccccccEEEEccccEEEEcccTTcTTcTHHHHHHHHHHHcc PSIPRED cEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHcccEEEEcccccHHHHHHHHHccccHHHHHHHHHHHccccEEEEEHHHHHHHHHHHcccccccccccccEEEEcccccccccccccccEEEEEEcccHHHccccccccEEEEEEEEEEEEEEcccccEEEEEccccEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHccc //