[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37659.1
DDBJ      :             import inner membrane translocase, subunit Tim44
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  112/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:235 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   91->229 2cw9A PDBj 1e-08 28.1 %
:RPS:SCOP  74->231 2cw9A1  d.17.4.13 * 3e-37 24.8 %
:HMM:SCOP  45->231 2cw9A1 d.17.4.13 * 1.4e-54 44.4 %
:RPS:PFM   91->230 PF04280 * Tim44 1e-30 42.9 %
:HMM:PFM   88->232 PF04280 * Tim44 4.9e-53 49.7 145/147  
:BLT:SWISS 98->229 TIM44_CAEEL 5e-12 28.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37659.1 GT:GENE ABE37659.1 GT:PRODUCT import inner membrane translocase, subunit Tim44 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(485824..486531) GB:FROM 485824 GB:TO 486531 GB:DIRECTION - GB:PRODUCT import inner membrane translocase, subunit Tim44 GB:PROTEIN_ID ABE37659.1 GB:DB_XREF GI:91681357 InterPro:IPR007379 LENGTH 235 SQ:AASEQ MDIYTIIFLALAVFIFLRLRNVLGQRTGSERPPFDRAAARDMIPGKQDNNVVPMPGTVIDQSPTAPNADVVPPSDRWKGIAEPDSPLAHGLNAVLVQDSSFDANHFLTGAKSAYEMIVMAFANGDRRALRDLLSTEVYDSFDAAIKDREKNERKTETRFVAIDKAELLGAEVREHTAQLTVKFVSQMISVTRDKAGAIVDGNPDKVADITDVWTFARDISSRDPNWKLVGTGSGH GT:EXON 1|1-235:0| BL:SWS:NREP 1 BL:SWS:REP 98->229|TIM44_CAEEL|5e-12|28.0|132/425| TM:NTM 1 TM:REGION 2->24| BL:PDB:NREP 1 BL:PDB:REP 91->229|2cw9A|1e-08|28.1|135/176| RP:PFM:NREP 1 RP:PFM:REP 91->230|PF04280|1e-30|42.9|140/147|Tim44| HM:PFM:NREP 1 HM:PFM:REP 88->232|PF04280|4.9e-53|49.7|145/147|Tim44| GO:PFM:NREP 3 GO:PFM GO:0005744|"GO:mitochondrial inner membrane presequence translocase complex"|PF04280|IPR007379| GO:PFM GO:0006886|"GO:intracellular protein transport"|PF04280|IPR007379| GO:PFM GO:0015450|"GO:P-P-bond-hydrolysis-driven protein transmembrane transporter activity"|PF04280|IPR007379| RP:SCP:NREP 1 RP:SCP:REP 74->231|2cw9A1|3e-37|24.8|157/182|d.17.4.13| HM:SCP:REP 45->231|2cw9A1|1.4e-54|44.4|171/0|d.17.4.13|1/1|NTF2-like| OP:NHOMO 150 OP:NHOMOORG 141 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------1111111111---------------------------------------------------------------------------1--------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------12-111------1-1---1161-111-----1-1---1-------1---11111---312-11-1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 57.4 SQ:SECSTR ##########################################################################################HHHHHHHcTTccHHHHHHHHHHTHHHHHHHHHHTcHHHHHHHccHHHHHHHHHHHHHHHHTTcEEccEEEEEEEEEEEEEE##TTEEEEEEEEEEEEE#EEEcTTccEEEEcTTccEEEE#EEEEEEcTTcccGcEEEE###### DISOP:02AL 25-63,234-236| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccccccccccccccHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcHHHHHHHHHHHHHHHHcccEEEEEEEEccccEEEEEEEEccEEEEEEEEEEEEEEEEEccccccccccccccEEEEEEEEEEEccccccccEEEEEEcccc //