[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37660.1
DDBJ      :             protein translocase subunit secB
Swiss-Prot:SECB_RHOPS   RecName: Full=Protein-export protein secB;

Homologs  Archaea  0/68 : Bacteria  409/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.33.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->151 1ozbF PDBj 7e-15 33.1 %
:RPS:SCOP  15->154 1fx3A  d.33.1.1 * 3e-08 31.7 %
:HMM:SCOP  15->149 1qynA_ d.33.1.1 * 4.8e-50 55.2 %
:RPS:PFM   15->150 PF02556 * SecB 8e-25 43.7 %
:HMM:PFM   12->153 PF02556 * SecB 1.9e-61 55.3 141/149  
:BLT:SWISS 1->158 SECB_RHOPS 5e-73 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37660.1 GT:GENE ABE37660.1 GT:PRODUCT protein translocase subunit secB GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 486979..487455 GB:FROM 486979 GB:TO 487455 GB:DIRECTION + GB:PRODUCT protein translocase subunit secB GB:PROTEIN_ID ABE37660.1 GB:DB_XREF GI:91681358 InterPro:IPR003708 LENGTH 158 SQ:AASEQ MTNGNGAPPEAVAAPQLNVLAQYTKDLSFENPNAPASLAQQQQQPAINIQINVGANNLAENEYEVTLSVEGKAESGSTVLFSFELAYAGVFRIVNVPQENLHPLIMIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFVGLYRQNMERQAQQGQPS GT:EXON 1|1-158:0| SW:ID SECB_RHOPS SW:DE RecName: Full=Protein-export protein secB; SW:GN Name=secB; OrderedLocusNames=RPD_0422; SW:KW Chaperone; Complete proteome; Cytoplasm; Protein transport;Translocation; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->158|SECB_RHOPS|5e-73|100.0|158/158| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0055085|"GO:transmembrane transport"|Translocation| GO:SWS GO:0006810|"GO:transport"|Transport| SEG 31->52|npnapaslaqqqqqpainiqin| BL:PDB:NREP 1 BL:PDB:REP 15->151|1ozbF|7e-15|33.1|136/148| RP:PFM:NREP 1 RP:PFM:REP 15->150|PF02556|8e-25|43.7|135/146|SecB| HM:PFM:NREP 1 HM:PFM:REP 12->153|PF02556|1.9e-61|55.3|141/149|SecB| GO:PFM:NREP 3 GO:PFM GO:0015031|"GO:protein transport"|PF02556|IPR003708| GO:PFM GO:0051082|"GO:unfolded protein binding"|PF02556|IPR003708| GO:PFM GO:0051262|"GO:protein tetramerization"|PF02556|IPR003708| RP:SCP:NREP 1 RP:SCP:REP 15->154|1fx3A|3e-08|31.7|139/143|d.33.1.1| HM:SCP:REP 15->149|1qynA_|4.8e-50|55.2|134/134|d.33.1.1|1/1|Bacterial protein-export protein SecB| OP:NHOMO 430 OP:NHOMOORG 411 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111111111222222221112111111111111111111111111111111111-1111111111111111111111111111111111111111111111111211111111111111111111111111----1-------------1--------------------------------------111111111-1111111111111111111111--111111--11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111-11-11111111111111111111111111111111111111111111111111111111112222222221-11111111-----11111111111111--1-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 86.1 SQ:SECSTR ##############cEEEEEEEEEEEEEEEcTTTTGGGGccccEEEEEEEE#EEEEEEETTEEEEEEEEEEEETTTccEEEEEEEEEEEEEEEEcccHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHTTccccccccccTHHHHHHHHHHH####### DISOP:02AL 1-1,36-36,38-42,44-44,146-159| PSIPRED ccccccccccccccccEEEEEEEEEEEEcccccccHHHHHHHHcccEEEEEEEccEEccccEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccc //