[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37661.1
DDBJ      :             DNA polymerase III, epsilon subunit
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  742/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->168 1j53A PDBj 2e-48 56.0 %
:RPS:PDB   4->226 3cg7B PDBj 1e-30 11.8 %
:RPS:SCOP  1->167 2f96A1  c.55.3.5 * 7e-38 25.6 %
:HMM:SCOP  1->177 2f96A1 c.55.3.5 * 1.3e-53 48.3 %
:RPS:PFM   4->162 PF00929 * Exonuc_X-T 1e-22 45.2 %
:HMM:PFM   4->163 PF00929 * Exonuc_X-T 3.4e-38 34.8 158/165  
:BLT:SWISS 1->218 DPO3E_RICFE 1e-56 49.1 %
:PROS 1->4|PS00228|TUBULIN_B_AUTOREG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37661.1 GT:GENE ABE37661.1 GT:PRODUCT DNA polymerase III, epsilon subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(487508..488203) GB:FROM 487508 GB:TO 488203 GB:DIRECTION - GB:PRODUCT DNA polymerase III, epsilon subunit GB:PROTEIN_ID ABE37661.1 GB:DB_XREF GI:91681359 InterPro:IPR002453 InterPro:IPR006054 InterPro:IPR006055 InterPro:IPR006309 LENGTH 231 SQ:AASEQ MREIVLDTETTGLDPLRGDRLVEIGCVEIYNRMPTGQAFHRYINPERDMPAEAFAVHGLSAEFLADKPLFAQVVDEFLDFIGDAPLVIHNASFDAGFLNAELARLSRAAIPRERLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVYIDLIGARQSQLILAEVPSERAGQGGDKPRRQRSTPLAARVTELDLDAHRAFIATMGDKAIWKEYPAGA GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 1->218|DPO3E_RICFE|1e-56|49.1|218/229| PROS 1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| BL:PDB:NREP 1 BL:PDB:REP 2->168|1j53A|2e-48|56.0|166/174| RP:PDB:NREP 1 RP:PDB:REP 4->226|3cg7B|1e-30|11.8|221/295| RP:PFM:NREP 1 RP:PFM:REP 4->162|PF00929|1e-22|45.2|157/163|Exonuc_X-T| HM:PFM:NREP 1 HM:PFM:REP 4->163|PF00929|3.4e-38|34.8|158/165|Exonuc_X-T| RP:SCP:NREP 1 RP:SCP:REP 1->167|2f96A1|7e-38|25.6|164/202|c.55.3.5| HM:SCP:REP 1->177|2f96A1|1.3e-53|48.3|174/0|c.55.3.5|1/1|Ribonuclease H-like| OP:NHOMO 1083 OP:NHOMOORG 753 OP:PATTERN -----------------------1--------------1-11-------------------------- -----------21111122-22--12222221-222-121--122111------1-11--1-2-11111111111----1-111-122-------1-----2-31-111122222222222222121-21211-2332211---12-------------------------------------11111--1532333332343333333242222333223221222222233211111111111111122122323213223222111121221-211122111111211111111111111111111111111111111111111-22222222211111-221221112221311-21-1-211111-1111-111111111122221111111122222222221111213111111111111111111112111213222222211111111111114211111-111111111111111111111111111111111112332322111122211111123312222122214221112321112422123211111111124332------1-1--------111-11--1--1-----1----------------12--111121212213221222322222232222222111152111111111111111111111111-11111111111211111112221111111111111211211111111111111111111111122111111111111111211111111111111111111111111-111121122223332122211111111112222111112222222111111111111111---------------111-1111-1-111--111111---1112322122212--- ----11-------------------------------------------------------------------------------------------------------------------------------------------------------------1---------11----2--------------3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 228 STR:RPRED 98.7 SQ:SECSTR ccEEEEEEEEcccTTcccccEEEEEEEEETTEEEEEEEEEEEccccccccHHHHHHHcccHHHHHTcccHHHHHHHHHHHHHTTEEEEEcccHHHHTHHHHHHHHTTccccHHHHHHHHHHHcccccccccHHHHHHHHHTccccccTHTcHHHHHHHHHHHHHHHHHTTccccccEEEEcccGGGGccccccTTGGGcHHHHHHHHHHHcccEEEEcccGGGccGGc### DISOP:02AL 175-196,230-232| PSIPRED ccEEEEEccccccccccccEEEEEEEEEEEccEEEcccEEEEEcccccccHHHHHHHcccHHHHcccccHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHccccccccccEEcHHHHHHHHcccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccc //