[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37662.1
DDBJ      :             Dephospho-CoA kinase
Swiss-Prot:COAE_RHOP2   RecName: Full=Dephospho-CoA kinase;         EC=2.7.1.24;AltName: Full=Dephosphocoenzyme A kinase;

Homologs  Archaea  0/68 : Bacteria  797/915 : Eukaryota  155/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->184 1vhlA PDBj 7e-20 32.6 %
:RPS:PDB   14->188 1a7jA PDBj 2e-20 14.9 %
:RPS:SCOP  2->188 1uf9A  c.37.1.1 * 1e-29 34.4 %
:HMM:SCOP  1->191 1dekA_ c.37.1.1 * 4.9e-35 35.3 %
:RPS:PFM   3->174 PF01121 * CoaE 1e-26 45.6 %
:HMM:PFM   2->175 PF01121 * CoaE 2e-43 39.5 172/180  
:BLT:SWISS 1->188 COAE_RHOP2 4e-96 91.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37662.1 GT:GENE ABE37662.1 GT:PRODUCT Dephospho-CoA kinase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(488243..488842) GB:FROM 488243 GB:TO 488842 GB:DIRECTION - GB:PRODUCT Dephospho-CoA kinase GB:PROTEIN_ID ABE37662.1 GB:DB_XREF GI:91681360 InterPro:IPR001977 LENGTH 199 SQ:AASEQ MLVLGLTGSIGMGKSTTAKLFEEAGVPVYDADATVHKIYEDEAAPAIEAAFPGTTANGKVDRTLLSAKVVHDTEAMKRLEQIVHPMLRSHHQNFLDDAEASGAPIAVVDVPLLFETGGEKRVDAVVVVTTSPEIQRERILARDNMTPEKLDAILARQMPDAEKRKRADFIVDTSHGLDPVRAQLDEILAAAARMPRRRP GT:EXON 1|1-199:0| SW:ID COAE_RHOP2 SW:DE RecName: Full=Dephospho-CoA kinase; EC=2.7.1.24;AltName: Full=Dephosphocoenzyme A kinase; SW:GN Name=coaE; OrderedLocusNames=RPB_0397; SW:KW ATP-binding; Coenzyme A biosynthesis; Complete proteome; Cytoplasm;Kinase; Nucleotide-binding; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->188|COAE_RHOP2|4e-96|91.0|188/199| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0015937|"GO:coenzyme A biosynthetic process"|Coenzyme A biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 189->198|aaaarmprrr| BL:PDB:NREP 1 BL:PDB:REP 3->184|1vhlA|7e-20|32.6|178/208| RP:PDB:NREP 1 RP:PDB:REP 14->188|1a7jA|2e-20|14.9|175/279| RP:PFM:NREP 1 RP:PFM:REP 3->174|PF01121|1e-26|45.6|169/179|CoaE| HM:PFM:NREP 1 HM:PFM:REP 2->175|PF01121|2e-43|39.5|172/180|CoaE| RP:SCP:NREP 1 RP:SCP:REP 2->188|1uf9A|1e-29|34.4|183/191|c.37.1.1| HM:SCP:REP 1->191|1dekA_|4.9e-35|35.3|184/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1035 OP:NHOMOORG 952 OP:PATTERN -------------------------------------------------------------------- 111-11111111111--11-11111-1111111111-1111111-1-1111111-1-1----111-111111111111-1-11111111111111----11111111-1111111111111111111-111111111111111111111111111111111-1111111111111-111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111-1--1111111-1-1-1111111111111111111-11111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111---11--111111111-11-1111-1111111111111111-1111111111111111111111111111111111111111111111111111111111111111-11111111-111111111111111111111111111111111111111111111-1-11-1-1111111111111111111111-111-1------11111111111111111-1111111111111111111111111111111111111-111111111111111111111111111-11111111111111111111111111111---111111111111111111111111111111111111111-1-11111111-11--1-1--1111111--1-111111----------1------------------------------111-11-1 ----111-21-11111111-1---1--------1111111-11---11-1-11-11---111111111-111111111-111111111-11111111-11111111-16-211122-2111221321318H6-212-2-232232-221121-22122222111111111211211221611122111312111----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 94.5 SQ:SECSTR cEEEEEEccTTccHHHHHHHHHHHTccEEGGGccccHHHHHHHHHHHHHTcTTcccGGGccHHHHHHHHHHHHHHcccEEccccccccccTTcccccEEcccccEEEEEEccTTcccccccccEEEEEEEcHHHHHHHHHHHTccccccHHHHHHHHHHHHHHGGTccEEEEEEEccccccGGGcccc########### DISOP:02AL 196-200| PSIPRED cEEEEEEccccccHHHHHHHHHHcccEEEEHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHccHHHHccEEEEEEccHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHccccccc //