[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37663.1
DDBJ      :             Maf-like protein
Swiss-Prot:Y425_RHOPS   RecName: Full=Maf-like protein RPD_0425;

Homologs  Archaea  6/68 : Bacteria  515/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
c.51.4
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->182 1ex2A PDBj 1e-18 34.8 %
:RPS:PDB   1->182 2carA PDBj 2e-27 9.9 %
:RPS:SCOP  8->182 2amhA1  c.51.4.2 * 4e-38 16.6 %
:HMM:SCOP  6->197 1ex2A_ c.51.4.2 * 6e-44 40.0 %
:RPS:PFM   10->182 PF02545 * Maf 1e-20 39.9 %
:HMM:PFM   9->197 PF02545 * Maf 3.6e-41 34.2 184/195  
:BLT:SWISS 1->202 Y425_RHOPS e-104 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37663.1 GT:GENE ABE37663.1 GT:PRODUCT Maf-like protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(488969..489577) GB:FROM 488969 GB:TO 489577 GB:DIRECTION - GB:PRODUCT Maf-like protein GB:PROTEIN_ID ABE37663.1 GB:DB_XREF GI:91681361 InterPro:IPR003697 LENGTH 202 SQ:AASEQ MTLWLGPQPLVLASQSRARQALLTNAGIPFEAIPAKLDERGIARVSGLSAPGDIAALLAQEKAAFVSNHHPGRLVLGADQTLALGAREFNKPADRNEAAKQLRELAGRRHELHSAIAVVRNGITLFAEVVIARMTMRPLSDEEIAVYLDEVGDTATCSVGGYQVEGLGVHLFDGIHGDHSTILGLPLLPLLGFLRSQKLLTL GT:EXON 1|1-202:0| SW:ID Y425_RHOPS SW:DE RecName: Full=Maf-like protein RPD_0425; SW:GN OrderedLocusNames=RPD_0425; SW:KW Complete proteome; Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->202|Y425_RHOPS|e-104|100.0|202/202| GO:SWS:NREP 1 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| SEG 183->194|lglpllpllgfl| BL:PDB:NREP 1 BL:PDB:REP 8->182|1ex2A|1e-18|34.8|164/185| RP:PDB:NREP 1 RP:PDB:REP 1->182|2carA|2e-27|9.9|171/196| RP:PFM:NREP 1 RP:PFM:REP 10->182|PF02545|1e-20|39.9|168/193|Maf| HM:PFM:NREP 1 HM:PFM:REP 9->197|PF02545|3.6e-41|34.2|184/195|Maf| GO:PFM:NREP 1 GO:PFM GO:0005737|"GO:cytoplasm"|PF02545|IPR003697| RP:SCP:NREP 1 RP:SCP:REP 8->182|2amhA1|4e-38|16.6|169/195|c.51.4.2| HM:SCP:REP 6->197|1ex2A_|6e-44|40.0|185/0|c.51.4.2|1/1|ITPase-like| OP:NHOMO 729 OP:NHOMOORG 550 OP:PATTERN ----1---------------------------------------------------11111------- 111----11111----------111------1----------------------11----11----------------1-1--1---------------11---1--111-------111111111111-1---1-11111---1111-1--111-----11---1-111--1-----1----11111111-111111111111111111111111111111-11------11--------------------1---11---------111----------------------------------------------------1-1------1-1-1-11--1-----1--1-11111111-1-1-111--1-1-1211111111122222111111211111111112-1111111122211111111111112222212-22222221111111112211222--11-111--11-11111111111-11111212121111111121111111111-111111-111111211111111111-11-221122122111111-1112211111111---1-----1-11112111112111-------------------------2212111121221211112111112-221212--22112------21222212222222222-2222222222222222222222211121212222222222222222122221-222222222222---2-----11112222------------------1--11---2212122222222221111---------211121111121-221222122222----1-1-----------------1----------------------------1--------1 -------------------------------------------------------------------------------------------------------------1-131112------------262-2--------1----------3-111111--11-1------11---13---1----1----1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 90.1 SQ:SECSTR HHHHHTTcEEEEEcccHHHHHHHHHHHcTTcccEEEEEccccccccccccHHHHHHHHHHHHHHHHccEEEEEEEGGGTTcEETTHHHHHHHHHHHHHHHTTTTccccEEEEEEEEEEEccccccccEEEEEEEEEEEccHHHHHHHccccccTTcTTGGGEEETTccccTTTccHHHHHHH#################### DISOP:02AL 1-6| PSIPRED ccccccccEEEEEcccHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEccEEEEEccEEccccccHHHHHHHHHHHcccEEEEEEEEEEEEcccEEEEEEEEEEEEEccccHHHHHHHHHHccccccccccEEEccccHHHHHHHHccccccEEHHHHHHHHHHHHHcccccc //