[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37664.1
DDBJ      :             protein of unknown function DUF299
Swiss-Prot:Y426_RHOPS   RecName: Full=Putative phosphotransferase RPD_0426;         EC=2.7.-.-;

Homologs  Archaea  0/68 : Bacteria  500/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
c.77.1
:279 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   105->185 1dxjA PDBj 2e-04 19.8 %
:RPS:SCOP  132->274 1lwdA  c.77.1.1 * 2e-04 15.9 %
:RPS:PFM   12->266 PF03618 * DUF299 5e-56 41.1 %
:HMM:PFM   10->266 PF03618 * DUF299 1.9e-92 43.9 255/255  
:BLT:SWISS 1->279 Y426_RHOPS e-155 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37664.1 GT:GENE ABE37664.1 GT:PRODUCT protein of unknown function DUF299 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(489574..490413) GB:FROM 489574 GB:TO 490413 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF299 GB:PROTEIN_ID ABE37664.1 GB:DB_XREF GI:91681362 InterPro:IPR005177 LENGTH 279 SQ:AASEQ MLTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPLVRSQKQLDRVLQEIEESPGIVLFTLLESELVNRLEAKCQQINSPSLSIIGPVMQLFEAYLGASTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQHVEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPDRLIQVRQNRLLSLGAGAGNDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRMSE GT:EXON 1|1-279:0| SW:ID Y426_RHOPS SW:DE RecName: Full=Putative phosphotransferase RPD_0426; EC=2.7.-.-; SW:GN OrderedLocusNames=RPD_0426; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->279|Y426_RHOPS|e-155|100.0|279/279| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| RP:PDB:NREP 1 RP:PDB:REP 105->185|1dxjA|2e-04|19.8|81/242| RP:PFM:NREP 1 RP:PFM:REP 12->266|PF03618|5e-56|41.1|253/255|DUF299| HM:PFM:NREP 1 HM:PFM:REP 10->266|PF03618|1.9e-92|43.9|255/255|DUF299| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF03618|IPR005177| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF03618|IPR005177| RP:SCP:NREP 1 RP:SCP:REP 132->274|1lwdA|2e-04|15.9|138/413|c.77.1.1| OP:NHOMO 543 OP:NHOMOORG 514 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1-----1---------1---------------111------------------------------------------------------111------1-------------------------------------111-----111111111111111111111111111111111122222212211111111111111222222111111-11111--11211------1111---1--------------------------1--------1-11-11111111111-1---1-1-1-221--111111121111111-------111111111111111111111111111111111-11111111111-11111111111111111----------11111111111-11111111111111--1111111111111111111111-111111111111111111111111111111111111111111111111111111111111111112111111-1-2----------111111111-----1-----------------------------11111-1111-1111111111111111111--1-111------11111111111111111-1111111111111111111111111111111111111111111111111111-1111111-1111---1-----1111-1111---------------11111111111-11111111111111111-------------1111111111111111111111111----------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------11181-1--1112-211------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 29.0 SQ:SECSTR ########################################################################################################TccccccTTTTcccHHHHHHHHHHHTccTTTcTTHHHHcHHHHHHHHHHHHHcccTTccHHHHHTTcccccHHHHHTTccc############################################################################################## DISOP:02AL 1-4,8-8,106-115,216-220,222-223,270-280| PSIPRED ccccccEEEEEEEEcHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccHHHHHHHHcccEEEEEcccccccccHHHHHccccEEEEEEccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHHHHcccccc //