[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37665.1
DDBJ      :             conserved hypothetical protein 701
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  320/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:RPS:PFM   8->145 PF03653 * UPF0093 7e-34 56.6 %
:HMM:PFM   5->146 PF03653 * UPF0093 9.5e-61 50.0 142/147  
:BLT:SWISS 5->144 Y2845_RHOS4 6e-33 50.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37665.1 GT:GENE ABE37665.1 GT:PRODUCT conserved hypothetical protein 701 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 490867..491307 GB:FROM 490867 GB:TO 491307 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein 701 GB:PROTEIN_ID ABE37665.1 GB:DB_XREF GI:91681363 InterPro:IPR005265 LENGTH 146 SQ:AASEQ MFDWSDFYLWVKAFHVIAVISWMAGMLYMPRLFVYHCAAEVGSVQSETFKIMERRLYKAIMNPAMIAAWAAGLVIAWQQSFFASGWFHAKLAAVVLMTVIHLLLGRYVRDFAADRNKRSHKFYRVINEIPTLLMVGAVIVVIVKPF GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 5->144|Y2845_RHOS4|6e-33|50.0|138/165| TM:NTM 4 TM:REGION 11->33| TM:REGION 59->81| TM:REGION 87->109| TM:REGION 123->145| RP:PFM:NREP 1 RP:PFM:REP 8->145|PF03653|7e-34|56.6|136/143|UPF0093| HM:PFM:NREP 1 HM:PFM:REP 5->146|PF03653|9.5e-61|50.0|142/147|UPF0093| OP:NHOMO 325 OP:NHOMOORG 320 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------111-----------111-11--1-1------------------------------------1111111--1111111111-1111-11111111-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111-----211111111112111111111111-111111111111111111111111111111-11111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211-1111111111111111111111--------------------------------1111111111111111111112-11-----1111111-----------------------1111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111---------1--------------1111111111----11--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccc //