[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37667.1
DDBJ      :             tRNA modification GTPase trmE
Swiss-Prot:MNME_RHOPS   RecName: Full=tRNA modification GTPase mnmE;         EC=3.6.-.-;

Homologs  Archaea  0/68 : Bacteria  860/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
a.118.1a.24.25d.250.1
:462 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->462 1xzqA PDBj 5e-46 38.1 %
:RPS:PDB   69->404 2e87A PDBj 2e-22 14.1 %
:RPS:SCOP  9->123 1xzpA3  d.250.1.2 * 1e-30 39.8 %
:RPS:SCOP  124->307 1xzpA1  a.24.25.1 * 1e-23 22.4 %
:RPS:SCOP  366->459 2iolA1  a.118.1.14 * 1e-06 4.4 %
:HMM:SCOP  7->123 1xzpA3 d.250.1.2 * 1.5e-35 50.9 %
:HMM:SCOP  124->462 1xzpA1 a.24.25.1 * 1.5e-51 45.0 %
:RPS:PFM   9->123 PF10396 * TrmE_N 1e-24 52.6 %
:RPS:PFM   221->277 PF02421 * FeoB_N 2e-05 44.4 %
:HMM:PFM   9->123 PF10396 * TrmE_N 2.4e-38 46.5 114/115  
:HMM:PFM   232->309 PF01926 * MMR_HSR1 1.2e-22 42.3 78/108  
:HMM:PFM   363->408 PF03308 * ArgK 0.00033 28.3 46/267  
:HMM:PFM   214->245 PF01144 * CoA_trans 0.00023 40.6 32/218  
:BLT:SWISS 3->462 MNME_RHOPS 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37667.1 GT:GENE ABE37667.1 GT:PRODUCT tRNA modification GTPase trmE GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 492960..494348 GB:FROM 492960 GB:TO 494348 GB:DIRECTION + GB:PRODUCT tRNA modification GTPase trmE GB:PROTEIN_ID ABE37667.1 GB:DB_XREF GI:91681365 InterPro:IPR002917 InterPro:IPR003593 InterPro:IPR004520 InterPro:IPR005225 InterPro:IPR005289 LENGTH 462 SQ:AASEQ MRMHPSDQTIFALATGQLPSAIAMVRVSGPRAGDLLTALTGSLPPPRTARRVLIRDQNQDLIDDGVALWFAGPASATGEDVAEFHIHGGRAVLAALVRALSAFDGVRPAEPGEFTRRAFENGKLDLTEAEGLDDLIHADTEAQRRQAVRQLGGLLGDRARRWRAQIIEATALIEAGIDFADEGDVQGELMAPALQTIAALHDEIAEVLAAQGRSERLRDGMVVAIAGPPNVGKSTLINRLARREVAIVSPHAGTTRDVIEVQLDLGGYPVTVIDTAGIRESNDPVEQEGVRRARARAAEADLVLWLGEGEMTGDAVAASAPVWRVRNKIDLRGGEGDGGPVGLPVEPLAAALRQTDGAWGGNAAFEISALRGQGLGELIAAIEDFAAQYFASGETALISRARHRTLLQDAAAMLQRSLQHDLPAELVAEELRLAGVALGRLLGRVDVEDVLGEIFSRFCIGK GT:EXON 1|1-462:0| SW:ID MNME_RHOPS SW:DE RecName: Full=tRNA modification GTPase mnmE; EC=3.6.-.-; SW:GN Name=mnmE; Synonyms=trmE; OrderedLocusNames=RPD_0429; SW:KW Complete proteome; Cytoplasm; GTP-binding; Hydrolase; Magnesium;Metal-binding; Nucleotide-binding; Potassium; tRNA processing. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 3->462|MNME_RHOPS|0.0|100.0|460/460| GO:SWS:NREP 6 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| SEG 90->100|ravlaalvral| SEG 291->298|rrararaa| SEG 330->348|dlrggegdggpvglpvepl| SEG 431->445|lrlagvalgrllgrv| BL:PDB:NREP 1 BL:PDB:REP 9->462|1xzqA|5e-46|38.1|441/449| RP:PDB:NREP 1 RP:PDB:REP 69->404|2e87A|2e-22|14.1|326/353| RP:PFM:NREP 2 RP:PFM:REP 9->123|PF10396|1e-24|52.6|114/117|TrmE_N| RP:PFM:REP 221->277|PF02421|2e-05|44.4|54/188|FeoB_N| HM:PFM:NREP 4 HM:PFM:REP 9->123|PF10396|2.4e-38|46.5|114/115|TrmE_N| HM:PFM:REP 232->309|PF01926|1.2e-22|42.3|78/108|MMR_HSR1| HM:PFM:REP 363->408|PF03308|0.00033|28.3|46/267|ArgK| HM:PFM:REP 214->245|PF01144|0.00023|40.6|32/218|CoA_trans| GO:PFM:NREP 4 GO:PFM GO:0005525|"GO:GTP binding"|PF02421|IPR011619| GO:PFM GO:0015093|"GO:ferrous iron transmembrane transporter activity"|PF02421|IPR011619| GO:PFM GO:0015684|"GO:ferrous iron transport"|PF02421|IPR011619| GO:PFM GO:0016021|"GO:integral to membrane"|PF02421|IPR011619| RP:SCP:NREP 3 RP:SCP:REP 9->123|1xzpA3|1e-30|39.8|113/117|d.250.1.2| RP:SCP:REP 124->307|1xzpA1|1e-23|22.4|170/173|a.24.25.1| RP:SCP:REP 366->459|2iolA1|1e-06|4.4|91/127|a.118.1.14| HM:SCP:REP 7->123|1xzpA3|1.5e-35|50.9|116/0|d.250.1.2|1/1|Folate-binding domain| HM:SCP:REP 124->462|1xzpA1|1.5e-51|45.0|171/0|a.24.25.1|1/1|TrmE connector domain| OP:NHOMO 1564 OP:NHOMOORG 1026 OP:PATTERN -------------------------------------------------------------------- 222-1---------1---------11-----1--------111-111111-11-11-111--11---1111--111111111-22111222222222112122112112211111112222222111111111112222221112-12222222222211222222222221111111111112222211121222222222122221221112222121112111111112221111111111111111111111111111111111221211-11111111222222111111111112222222223212222112222121222222222222222222222122112232222322222221112133112211211111212222222222222222222212-22222212212211121112211221222222222212211111111222221221122211211111222112112111212211111222222222222222222222222222222222222222111111111112222222222222222222122112131221221121232133212----1-212221122222222222222212121111111222121111111221222122111111-2122211111112221121111111111-11111111111111111112221211211111111111111112111111121122222222222111111111111122122222222222222222222222211222222222222222222221111111112222222222222222222222223222222221111112221221222111121-23121121221112221111211222222221 11--111--------11111111111111111111111111111111111111121111111111111111111111-1111111111-1311111----111111-1312111113-11-11121111292-112-1111111-111-111121---113-1111-111211-12223F222332--1121-23-323 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 452 STR:RPRED 97.8 SQ:SECSTR ########cEEEEcccccccccccEEEEccTHHHHHHTEccccccTTccEEEEEEc#cccEEEEEEEETTTTcccccHHHHHHHHHHHHHHHHHHHHHHHHT#HTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccGGHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHcccccccccEEEEEccTTccHHHHHHHHcccccEEEccTTccccEEEEEEEETTEEEEEEEcTTTcccccTTccHHHHHHHHGGGGTccEEEEEEcTTcTTcccHHHHHHHHHHHHHTTTccEEEEEccTTTccHHHHHHHHHHHHHTTcccEEccTTTTcTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHTccccHHHHHHHHHTcccTc DISOP:02AL 1-4,151-152,210-215| PSIPRED cccccccccEEEEEcccccccEEEEEEcHHHHHHHHHHHHccccccEEEEEEEEEcccccEEEEEEEEEEcccccccccEEEEEEEccHHHHHHHHHHHHHcccccEEEccccHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHcccEEEEccccccEEEEEEEEEEEccEEEEEEEcccEEccHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccc //