[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37677.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  102/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->188 PF03734 * YkuD 1e-10 30.7 88/116  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37677.1 GT:GENE ABE37677.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(507145..507714) GB:FROM 507145 GB:TO 507714 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37677.1 GB:DB_XREF GI:91681375 LENGTH 189 SQ:AASEQ MKITFRSERYKNPTVDRPLSMLQVRAAAGQRSRGWLTAGGMTIPVALGRGGILANKREGDGGTPRGTFRPRRLWWRADRWPKPRTFLPVRPITAEDAWCEDPSSRHYNRPLRRGPGEAGDRLQRADHLYDFIIEIDHNTTPRIAGRGSAVFLHLARDNFGPTAGCVAMTRGNLLRLLARIGPNTKIVIG GT:EXON 1|1-189:0| SEG 59->72|gdggtprgtfrprr| HM:PFM:NREP 1 HM:PFM:REP 41->188|PF03734|1e-10|30.7|88/116|YkuD| OP:NHOMO 103 OP:NHOMOORG 102 OP:PATTERN -------------------------------------------------------------------- --------------------------------------111-----------------------1-----------------------------------------------------------------------------------------------------1-----------------------------------------------------1------1-1--------------------------------------------------------------------------------------------------------------------------------------------------11111-1--111111111111111111111111-11111111111-1111111111111111111111111111111111111111-11-----------------------------1--1-1--------------------------------------------------------------------------------2----1111-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19| PSIPRED cccccccccccccccccEEEEEEEEccccccccEEEEEccEEEEEEEccccccccccccccccccccccccHHccccccccccccccEEEEEccccccccccccccccccEEccccccccccccccccccEEEEEcccccccccccccEEEEEEEccccccccEEEEccHHHHHHHHHHcccccEEEEc //