[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37701.1
DDBJ      :             protein of unknown function UPF0047
Swiss-Prot:             

Homologs  Archaea  59/68 : Bacteria  238/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
d.273.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->141 1vphF PDBj 4e-25 39.4 %
:RPS:PDB   6->139 2cu5B PDBj 2e-31 32.3 %
:RPS:SCOP  1->141 1vphA  d.273.1.1 * 7e-39 38.0 %
:HMM:SCOP  1->141 1vphA_ d.273.1.1 * 6.1e-43 44.5 %
:RPS:PFM   19->134 PF01894 * UPF0047 3e-17 40.7 %
:HMM:PFM   19->136 PF01894 * UPF0047 3.2e-37 43.4 113/118  
:BLT:SWISS 1->141 Y771_METTH 4e-25 41.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37701.1 GT:GENE ABE37701.1 GT:PRODUCT protein of unknown function UPF0047 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(532026..532454) GB:FROM 532026 GB:TO 532454 GB:DIRECTION - GB:PRODUCT protein of unknown function UPF0047 GB:PROTEIN_ID ABE37701.1 GB:DB_XREF GI:91681399 InterPro:IPR001602 LENGTH 142 SQ:AASEQ MNIVRHRIELATTAPIQIIDITEQVRGFVAGSGLGDGLVTVSCLHTTARINVNEREPQLERDMLTFLKRFAPRDGDYLHNLAPIDGRDNAHSHLIGLFMNSSETIPLAGGAMVLGEWQSIFFIELDGPRERRGVELQIIGQV GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 1->141|Y771_METTH|4e-25|41.2|136/143| BL:PDB:NREP 1 BL:PDB:REP 1->141|1vphF|4e-25|39.4|137/143| RP:PDB:NREP 1 RP:PDB:REP 6->139|2cu5B|2e-31|32.3|124/127| RP:PFM:NREP 1 RP:PFM:REP 19->134|PF01894|3e-17|40.7|113/120|UPF0047| HM:PFM:NREP 1 HM:PFM:REP 19->136|PF01894|3.2e-37|43.4|113/118|UPF0047| RP:SCP:NREP 1 RP:SCP:REP 1->141|1vphA|7e-39|38.0|137/138|d.273.1.1| HM:SCP:REP 1->141|1vphA_|6.1e-43|44.5|137/0|d.273.1.1|1/1|YjbQ-like| OP:NHOMO 430 OP:NHOMOORG 317 OP:PATTERN 1111111111111111111111111--111-111111-1111111-122-21212222222---1111 -12------------1111-11---111111-1-------1-------------------------1---1----------1121222--------------------1----------------32122312222---11111-12222111-----1111111-12222-11----2---------221-11---------------111111---111-1---------1------------------------------------------------------------------------------------------2--11---------12-22-111--2-----12112-22222122221---11---1-----11122--133333------------111111111---111111111111-11-11-1----11----------11----------------------------------1-1--------1111111----11111111-1111------------------1---11212------------1-1-212-222122112-21221222211212132----------------------12------------------------------------2111----------------------------------------------11--------------------------------------------------11111---------------------------------------------------------1------------------------------22------------------------------------------221222222212- -----------11------------1------------------------1------------------------------111-1----------------------2-----------------------------------------------------1----------1--22161111--------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 99.3 SQ:SECSTR cEEEEEEEEEEEccccEEEEcHHHHHHHHTTcccccEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHcccccTTcccGTcTcTTccHHHHHHHHHHccEEEEEEETTEEcccTTcEEEEEEcccccEEEEEEEEEcEc# DISOP:02AL 1-3| PSIPRED ccEEEEEEEEEccccEEEEEcHHHHHHHHHHccccccEEEEEEccccEEEEEEEccHHHHHHHHHHHHHHcccccccEEccccccccccHHHHHHHHHHccEEEEEEEccEEccccEEEEEEEEcccccccEEEEEEEEEcc //