[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37710.1
DDBJ      :             protein of unknown function DUF589
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  266/915 : Eukaryota  43/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:137 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->137 2gbsA PDBj 1e-63 78.8 %
:RPS:PDB   1->136 2ar1A PDBj 7e-39 38.1 %
:RPS:SCOP  3->137 1zceA1  b.122.1.8 * 5e-41 46.7 %
:HMM:SCOP  2->137 2gbsA1 b.122.1.8 * 1.4e-49 53.7 %
:RPS:PFM   3->134 PF01878 * DUF55 2e-25 47.7 %
:HMM:PFM   2->134 PF01878 * DUF55 1.6e-48 55.0 131/143  
:BLT:SWISS 2->134 THYN1_HUMAN 1e-11 33.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37710.1 GT:GENE ABE37710.1 GT:PRODUCT protein of unknown function DUF589 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 544215..544628 GB:FROM 544215 GB:TO 544628 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF589 GB:PROTEIN_ID ABE37710.1 GB:DB_XREF GI:91681408 InterPro:IPR007628 LENGTH 137 SQ:AASEQ MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNEGKEIIGIAEIIREAYPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSVQPVTADEWKLICKMGGL GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 2->134|THYN1_HUMAN|1e-11|33.8|133/225| SEG 56->70|egkeiigiaeiirea| BL:PDB:NREP 1 BL:PDB:REP 1->137|2gbsA|1e-63|78.8|137/145| RP:PDB:NREP 1 RP:PDB:REP 1->136|2ar1A|7e-39|38.1|134/157| RP:PFM:NREP 1 RP:PFM:REP 3->134|PF01878|2e-25|47.7|130/142|DUF55| HM:PFM:NREP 1 HM:PFM:REP 2->134|PF01878|1.6e-48|55.0|131/143|DUF55| RP:SCP:NREP 1 RP:SCP:REP 3->137|1zceA1|5e-41|46.7|135/146|b.122.1.8| HM:SCP:REP 2->137|2gbsA1|1.4e-49|53.7|136/0|b.122.1.8|1/1|PUA domain-like| OP:NHOMO 325 OP:NHOMOORG 311 OP:PATTERN ------------------------------------------------------------------11 -11------------------------------------------------------------------------------------1-----------------111-1--------------------------11111---1----1---11--------1-11------11--1----111-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1-1---111111111111111111111111111111-11111111111111111111111111-1-11111111111111111111111111--111111-----------------1-1111111------1111111-11111111111111111111--1111--111-1-1-11-11-1---------111-111-----1111-111111111111111111----------------------------11---111--11-11111---1111-1--1------111--------------------------------------------------------------------------------------------111111----1-1-1-----------------------1--11111-11111111-111-------------1-----111-11111111111-111------1111-----------------------------------------------1- --------211--------1--11-1----------------1-----11------1----------------1----------------------------------1-1-------1---111--21333-1-1----1-111-----1--1----1-----1----------111-6---1111-1-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEcTTTccHHHHHHHcETcEEccccccHHHHHHHHHccTTcEEEEEEccccccEEEEEEEEEEEEEcGGccccccEEEEEEEEEEEEEEEEHHHHTTcGGGTTcHHHHcccccEEEEcHHHHHHHHHHHHc PSIPRED ccccccccccccccHHHHHHccccccccccEEHHHHHHHHHHHccccEEEEEEcccccHHEEHHHHHHHHccccccccccEEEEEEEEEHHHcccccHHHHHccccccccEEEcccccccccccHHHHHHHHHHccc //