[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37713.1
DDBJ      :             ErfK/YbiS/YcfS/YnhG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  329/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   115->175 1y7mA PDBj 1e-09 45.0 %
:RPS:SCOP  43->173 1zatA1  b.160.1.1 * 2e-22 23.3 %
:HMM:SCOP  37->175 1y7mA1 b.160.1.1 * 1.3e-32 41.7 %
:RPS:PFM   44->172 PF03734 * YkuD 1e-11 40.6 %
:HMM:PFM   45->173 PF03734 * YkuD 5e-21 38.0 108/116  
:HMM:PFM   26->54 PF07372 * DUF1491 0.00083 20.7 29/104  
:BLT:SWISS 46->173 ERFK_ECOLI 6e-21 42.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37713.1 GT:GENE ABE37713.1 GT:PRODUCT ErfK/YbiS/YcfS/YnhG GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 548292..548819 GB:FROM 548292 GB:TO 548819 GB:DIRECTION + GB:PRODUCT ErfK/YbiS/YcfS/YnhG GB:PROTEIN_ID ABE37713.1 GB:DB_XREF GI:91681411 InterPro:IPR005490 LENGTH 175 SQ:AASEQ MSFGFRSAKTAGAVAALASAFVLTAPDAQARPDLVSFRGDYSPGTIVVKTNERRLYLVVEPGQAVRYPVGVGKAGKRWEGVTKIDGKYRNPAWSPPADVKRDNPAIPDVIPGGTPENPMGVAAMTLAGGEYAIHGTNRPNSVGGFVSYGCIRMLNDDISDLYQRVSVGTQVLVTR GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 46->173|ERFK_ECOLI|6e-21|42.9|126/310| SEG 7->25|saktagavaalasafvlta| BL:PDB:NREP 1 BL:PDB:REP 115->175|1y7mA|1e-09|45.0|60/161| RP:PFM:NREP 1 RP:PFM:REP 44->172|PF03734|1e-11|40.6|128/136|YkuD| HM:PFM:NREP 2 HM:PFM:REP 45->173|PF03734|5e-21|38.0|108/116|YkuD| HM:PFM:REP 26->54|PF07372|0.00083|20.7|29/104|DUF1491| RP:SCP:NREP 1 RP:SCP:REP 43->173|1zatA1|2e-22|23.3|116/126|b.160.1.1| HM:SCP:REP 37->175|1y7mA1|1.3e-32|41.7|115/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 902 OP:NHOMOORG 330 OP:PATTERN -------------------------------------------------------------------- -11----------------------------------------------------------------------------------122----------------------------------------------------------2111111--11-1-211--1-1122--------------------11211111122222222221---12221221---------22-------------------------------------------------------------------------------------------111-111--1----1111-----11---------32112-21-------11-----1111168B9966788A9855554454548-ADAAE89A79--677598A9898867---A136566323-----------------------------------------------------------------------------------------------------------12111111111-------------1-----22211121222-2--21-------------------------22331-1-1---111111111111111111111-11111------43222314444444444-444444444444444444444422111443444444443434424344443111-1-11111111-1--1111111112-11----------------------1---1-11111111111111111-------------11111111111----------------1---------------------------------------------11111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 74.9 SQ:SECSTR ######################################ccccEEccEEEccccEEETHHHHHHHGGGGGGEEccHHHHTTccTTcTTHHHHHTTcccEEEEcTTccEEE#####ccGGGTTEEEEEccTTcEEEccccGGGTTcEEEcccEEc#HHHHHHHHHHccTTcEEEEEc DISOP:02AL 1-7| PSIPRED cccccccccccHHHHHHHHEEEEEccccccccEEEccccccccEEEEEEccccEEEEEEccEEEEEEEEEEccccccccEEEEEEEEEEcccccccHHHccccccccccccccccccccccEEEEccccEEEEEEcccccccccccccccEEccHHHHHHHHHHcccccEEEEEc //