[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37718.1
DDBJ      :             succinate dehydrogenase subunit D
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.21.2
:140 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  30->113 1nekD  f.21.2.2 * 2e-16 20.2 %
:HMM:SCOP  24->136 1nekD_ f.21.2.2 * 3e-27 32.7 %
:HMM:PFM   17->125 PF01127 * Sdh_cyt 6e-18 23.1 108/121  
:BLT:SWISS 19->117 DHSD_PARDE 9e-07 25.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37718.1 GT:GENE ABE37718.1 GT:PRODUCT succinate dehydrogenase subunit D GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(554926..555348) GB:FROM 554926 GB:TO 555348 GB:DIRECTION - GB:PRODUCT succinate dehydrogenase subunit D GB:PROTEIN_ID ABE37718.1 GB:DB_XREF GI:91681416 InterPro:IPR000701 LENGTH 140 SQ:AASEQ MSGEESHGATRRQAASMRTPMGKVRKLGPAGSGTSDFWQQRITGVAMTLLTLPVVVVVMMLLGRNQAGAAQILGSPLISLTMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNFFTIAVALAAIFAIFKLASGV GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 19->117|DHSD_PARDE|9e-07|25.3|99/129| TM:NTM 3 TM:REGION 42->64| TM:REGION 76->98| TM:REGION 113->135| SEG 47->62|mtlltlpvvvvvmmll| SEG 120->137|fftiavalaaifaifkla| HM:PFM:NREP 1 HM:PFM:REP 17->125|PF01127|6e-18|23.1|108/121|Sdh_cyt| RP:SCP:NREP 1 RP:SCP:REP 30->113|1nekD|2e-16|20.2|84/113|f.21.2.2| HM:SCP:REP 24->136|1nekD_|3e-27|32.7|113/0|f.21.2.2|1/1|Fumarate reductase respiratory complex transmembrane subunits| OP:NHOMO 64 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-11111111111111111111111-11111111111-111111113111111--------------------1---1-----------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------1-11------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-30| PSIPRED cccHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //