[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37723.1
DDBJ      :             beta-Ig-H3/fasciclin
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  147/915 : Eukaryota  68/199 : Viruses  0/175   --->[See Alignment]
b.118.1
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   84->193 1w7eA PDBj 1e-29 58.7 %
:RPS:SCOP  87->193 1nyoA  b.118.1.1 * 8e-26 44.9 %
:HMM:SCOP  55->193 1o70A2 b.118.1.1 * 1.1e-40 47.8 %
:RPS:PFM   85->193 PF02469 * Fasciclin 2e-15 53.4 %
:HMM:PFM   66->193 PF02469 * Fasciclin 2.3e-38 46.7 122/131  
:BLT:SWISS 43->193 Y1483_SYNY3 2e-25 43.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37723.1 GT:GENE ABE37723.1 GT:PRODUCT beta-Ig-H3/fasciclin GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 560248..560832 GB:FROM 560248 GB:TO 560832 GB:DIRECTION + GB:PRODUCT beta-Ig-H3/fasciclin GB:PROTEIN_ID ABE37723.1 GB:DB_XREF GI:91681421 InterPro:IPR000782 LENGTH 194 SQ:AASEQ MSKRIAYLSAAALSALALTATAMAPANAEDKKMMKSEMSGEKTVMVGGAPMYPSKNIVENAVNSKDHSTLVAAVKAAGLVKTLEGKGPFTVFAPTNAAFGKLPAGTVDTLVKPESKATLTKILTYHVVPGKLAAADLTDGKKLTTVEGATLTVKRSGDQVMLVDAKGGSSTVTIPNVNQSNGVIHVVDTVLMPS GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 43->193|Y1483_SYNY3|2e-25|43.4|145/180| SEG 6->28|aylsaaalsalaltatamapana| SEG 31->42|kkmmksemsgek| SEG 69->83|tlvaavkaaglvktl| BL:PDB:NREP 1 BL:PDB:REP 84->193|1w7eA|1e-29|58.7|104/133| RP:PFM:NREP 1 RP:PFM:REP 85->193|PF02469|2e-15|53.4|103/129|Fasciclin| HM:PFM:NREP 1 HM:PFM:REP 66->193|PF02469|2.3e-38|46.7|122/131|Fasciclin| RP:SCP:NREP 1 RP:SCP:REP 87->193|1nyoA|8e-26|44.9|98/163|b.118.1.1| HM:SCP:REP 55->193|1o70A2|1.1e-40|47.8|138/157|b.118.1.1|1/1|FAS1 domain| OP:NHOMO 428 OP:NHOMOORG 221 OP:PATTERN -------------------------------------------1--3--1212--------------- 1-2-1--1---------22-22--1-22222-2222-111----1-------121-------1-----14-----------------------------2-1-34-1231-------------------------------111--22422214322------22146642------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1-11------12322---11111----------1-11-11-1--2--111121111111---4122-111132---------1-------------------------------------32-2-1-------------------------1---1----11--1111111----1-----------------------------------------1-1-----------------------------------------1---1-------------------------------------------------------------------------------------------------------1----------------------------1----------------------221---------1----------------------1-----1-1--1111111111--------11---------------------------------------------------1- ------4----------11--------------------------------2-11-1-1---------------------------------------------1---1-G1221442222221652427P2-725122151111112213113---21-----57---1---3--1--1---121---1--41----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 57.2 SQ:SECSTR ###################################################################################TcccccEEEcccHHHHHHccTTHHHHHHcTHHHHHHHHTHHHHcccccccHHHHcccEEEEETTTEEEEEEcTTccEETTccEETTcccccccccccccEEEccccccccc DISOP:02AL 1-3,28-43| PSIPRED cccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccEEEEEcccccccccHHHHHHHccccHHHHHHHHHcccEEEccccccEEEEEccHHHHHHccHHHHHHHHccccHHHHHHHHHHHEEccEEcHHHHccccEEEEccccEEEEEEEccEEEEEcccccEEEEEEccEEEcccEEEEEEEEEccc //