[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37727.1
DDBJ      :             major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:394 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->394 1pw4A_ f.38.1.1 * 2e-41 25.3 %
:RPS:PFM   26->102 PF06779 * DUF1228 5e-10 49.4 %
:HMM:PFM   25->107 PF06779 * DUF1228 1.6e-24 38.6 83/85  
:HMM:PFM   284->387 PF07690 * MFS_1 0.00017 23.3 103/353  
:HMM:PFM   172->196 PF03137 * OATP 0.00039 40.0 25/540  
:BLT:SWISS 18->105 ARAJ_ECOLI 9e-06 34.1 %
:BLT:SWISS 178->363 YJIJ_ECOLI 1e-06 31.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37727.1 GT:GENE ABE37727.1 GT:PRODUCT major facilitator superfamily MFS_1 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(563283..564467) GB:FROM 563283 GB:TO 564467 GB:DIRECTION - GB:PRODUCT major facilitator superfamily MFS_1 GB:PROTEIN_ID ABE37727.1 GB:DB_XREF GI:91681425 InterPro:IPR007114 InterPro:IPR010645 InterPro:IPR011701 LENGTH 394 SQ:AASEQ MTLLDRTEAPVHPARLILILSLAPTVGLGIGRFAYSLLLPDMRDSLQWSYSAAGFMNTINAAGYLAGALITSQLVRRYGLSAIVRVGTLGCVLSLALCALSGNFVLLSAARLIAGIGAALAFVAGGALATTIAQSQPQRSAFLLSLFYAGPGLGILSSGLITPFLLQAAGPGSWWIGWLVMAALSAVMTLPLLLAPLDSHASMSGGPATTFSIRPVLIYLVGYFMFGAGYIAYMTFMIAYVRDAGGGPAAQSAFWCLIGASAFVTPWVWRRIMALDRGGVSTTIILAVNALGAALPLFGLSPLILAISALVFGVSFFAVVASTTAFVRFNYAQAAWPGAIAAMTIAFGIGQTLGPLAVGAITDAVGSLSSALAVSAATLALGAVFSAFQRPLKR GT:EXON 1|1-394:0| BL:SWS:NREP 2 BL:SWS:REP 18->105|ARAJ_ECOLI|9e-06|34.1|88/394| BL:SWS:REP 178->363|YJIJ_ECOLI|1e-06|31.5|181/392| TM:NTM 12 TM:REGION 12->34| TM:REGION 54->75| TM:REGION 88->110| TM:REGION 113->135| TM:REGION 143->165| TM:REGION 176->198| TM:REGION 217->239| TM:REGION 248->269| TM:REGION 273->295| TM:REGION 303->325| TM:REGION 338->360| TM:REGION 369->391| SEG 106->129|llsaarliagigaalafvaggala| SEG 152->161|glgilssgli| SEG 308->322|salvfgvsffavvas| SEG 364->384|avgslssalavsaatlalgav| RP:PFM:NREP 1 RP:PFM:REP 26->102|PF06779|5e-10|49.4|77/85|DUF1228| HM:PFM:NREP 3 HM:PFM:REP 25->107|PF06779|1.6e-24|38.6|83/85|DUF1228| HM:PFM:REP 284->387|PF07690|0.00017|23.3|103/353|MFS_1| HM:PFM:REP 172->196|PF03137|0.00039|40.0|25/540|OATP| HM:SCP:REP 1->394|1pw4A_|2e-41|25.3|387/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------1111-11111111--111----------------------1-11--1-------11-11--1--------------------------------------------------------1-1111-----1111------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,4-7,196-210,393-395| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //