[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37731.1
DDBJ      :             aspartate semialdehyde dehydrogenase
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  838/915 : Eukaryota  89/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:344 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->332 2qz9B PDBj 3e-89 50.8 %
:RPS:PDB   3->331 1brmC PDBj 3e-48 24.0 %
:RPS:SCOP  2->157 2gyyA1  c.2.1.3 * 5e-37 39.6 %
:RPS:SCOP  129->319 1brmA2  d.81.1.1 * 2e-67 31.1 %
:HMM:SCOP  2->156 2g17A1 c.2.1.3 * 2.4e-50 50.0 %
:HMM:SCOP  129->319 1brmA2 d.81.1.1 * 6.2e-81 51.3 %
:RPS:PFM   4->115 PF01118 * Semialdhyde_dh 9e-18 43.6 %
:RPS:PFM   139->318 PF02774 * Semialdhyde_dhC 2e-34 52.5 %
:HMM:PFM   139->318 PF02774 * Semialdhyde_dhC 3.5e-57 44.4 178/184  
:HMM:PFM   4->116 PF01118 * Semialdhyde_dh 8.4e-33 41.1 112/121  
:BLT:SWISS 1->337 DHAS_AQUAE e-105 56.7 %
:PROS 229->243|PS01103|ASD

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37731.1 GT:GENE ABE37731.1 GT:PRODUCT aspartate semialdehyde dehydrogenase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 567499..568533 GB:FROM 567499 GB:TO 568533 GB:DIRECTION + GB:PRODUCT aspartate semialdehyde dehydrogenase GB:PROTEIN_ID ABE37731.1 GB:DB_XREF GI:91681429 InterPro:IPR000319 InterPro:IPR000534 InterPro:IPR005986 InterPro:IPR012280 LENGTH 344 SQ:AASEQ MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDKTLKCKALEHYDFSDVDICLMSAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALKPLHDHAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTNSELVNKKFPKRIAFNVIPEIDVFMEDGYTKEEWKMMVETKKILDPAIKLSATCVRVPVFVGHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGYVTPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAKKKAA GT:EXON 1|1-344:0| BL:SWS:NREP 1 BL:SWS:REP 1->337|DHAS_AQUAE|e-105|56.7|337/340| PROS 229->243|PS01103|ASD|PDOC00847| BL:PDB:NREP 1 BL:PDB:REP 3->332|2qz9B|3e-89|50.8|327/335| RP:PDB:NREP 1 RP:PDB:REP 3->331|1brmC|3e-48|24.0|329/359| RP:PFM:NREP 2 RP:PFM:REP 4->115|PF01118|9e-18|43.6|110/120|Semialdhyde_dh| RP:PFM:REP 139->318|PF02774|2e-34|52.5|162/165|Semialdhyde_dhC| HM:PFM:NREP 2 HM:PFM:REP 139->318|PF02774|3.5e-57|44.4|178/184|Semialdhyde_dhC| HM:PFM:REP 4->116|PF01118|8.4e-33|41.1|112/121|Semialdhyde_dh| GO:PFM:NREP 8 GO:PFM GO:0005737|"GO:cytoplasm"|PF01118|IPR000534| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01118|IPR000534| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF01118|IPR000534| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01118|IPR000534| GO:PFM GO:0005737|"GO:cytoplasm"|PF02774|IPR012280| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF02774|IPR012280| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF02774|IPR012280| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF02774|IPR012280| RP:SCP:NREP 2 RP:SCP:REP 2->157|2gyyA1|5e-37|39.6|149/150|c.2.1.3| RP:SCP:REP 129->319|1brmA2|2e-67|31.1|180/210|d.81.1.1| HM:SCP:REP 2->156|2g17A1|2.4e-50|50.0|152/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 129->319|1brmA2|6.2e-81|51.3|191/0|d.81.1.1|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 1212 OP:NHOMOORG 987 OP:PATTERN 11-1--2322222222-11111121111111111111111111-111111111111111-211-1-11 2211211111111111111-11111111111111111111121111111111-111-111221111122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222222212222321111112221111111111111111111111111111111111111-1111111-121111-11111111111111111111111111111-------------111111111111122111111111111111111111-111111111111121111111-1111222111111112221111111111111111111-111111111121111111111111111111111111111111111111111111111111122111111111111111111111111111-----1111111111111111111-1111-1-111111---11111---111111122111111111111111111111111111122222121222222112111111111111111111111111111221211111221111111111111111111--1111111111122222222222222222-2222222222222222222333222222222222222222222222222222-22222222222211211111111111211122221222222211211111111112122222222222222222111--1111122222222222222111111111111111111111111----------1-------------------------1111111111111 ------1-----111-------1----1111-1-11-11111111-11------11-11---1111111-1111111-111111111--121---11111-11111-11-------------------------------------------------1--------------1-1111G112111113-111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 337 STR:RPRED 98.0 SQ:SECSTR ccEEEEEEcTTcHHHHHHHHHHHHHTGGGcEEEEEcccccTTcccTTccccccccTTcHHHHHTccEEEEcccHHHHHHHHHHHHTTTcEEEEcccTTTTcTTEEEEcHHHHHHHHHHHHHTTEEEEccHHHHHHHHHHHHHHTTTcEEEEEEEEEEccTTTcHHHHHHHHHHHHHHHccHHHHHHHHHHHTTTccccccTTcccccccccccccHHHHHHHTTccccEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHTcccccccHHHHHHHccHHHHTTcccccEEEEEEcTTcTTEEEEEEEEETTcccccHHHHHHHHHHHHHccc####### DISOP:02AL 341-345| PSIPRED ccEEEEEEccccHHHHHHHHHHHcccccEEEEEEEEccccccEEccccccEEEEEEccHHHHccccEEEEccccHHHHHHHHHHHHcccEEEEcccccccccccEEEEccccHHHHcccHHccEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHcccccccccccHHcccccccEEEccccccccHHHHHHHHHHHHccccccEEEEEEEEccccccEEEEEEEEEcccccHHHHHHHHHHccccEEEEcccccccccHHHHcccccEEEEEEEEccccccEEEEEEEEccccccHHHHHHHHHHHHHHcccccHHHHcc //