[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37732.1
DDBJ      :             Uncharacterized protein UPF0114
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  226/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   24->142 PF03350 * UPF0114 2e-17 43.7 %
:HMM:PFM   24->142 PF03350 * UPF0114 1e-40 44.5 119/124  
:HMM:PFM   130->177 PF07690 * MFS_1 0.00019 31.2 48/353  
:BLT:SWISS 17->175 Y3357_KLEP7 7e-30 41.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37732.1 GT:GENE ABE37732.1 GT:PRODUCT Uncharacterized protein UPF0114 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 568675..569241 GB:FROM 568675 GB:TO 569241 GB:DIRECTION + GB:PRODUCT Uncharacterized protein UPF0114 GB:PROTEIN_ID ABE37732.1 GB:DB_XREF GI:91681430 InterPro:IPR005134 LENGTH 188 SQ:AASEQ MTDQPDLPKSPSPIKRVERGFETLLFNSRWLMAPFYFGLVLSLLVLLYKFVVLLAELILHASLAKESDIILGVLSLIDVSLTGNLVLIVVFSGYENFVSRIDPRDHPDWPEWMTKVDFAGLKQKLLASIVAISAIQVLKAFMNLDAGYDPTRLGWLVGIHLVFVVSTLLMALSDRWGSDHGSGDKAGH GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 17->175|Y3357_KLEP7|7e-30|41.8|158/164| TM:NTM 4 TM:REGION 37->59| TM:REGION 71->93| TM:REGION 124->146| TM:REGION 153->175| SEG 39->54|lvlsllvllykfvvll| RP:PFM:NREP 1 RP:PFM:REP 24->142|PF03350|2e-17|43.7|119/124|UPF0114| HM:PFM:NREP 2 HM:PFM:REP 24->142|PF03350|1e-40|44.5|119/124|UPF0114| HM:PFM:REP 130->177|PF07690|0.00019|31.2|48/353|MFS_1| OP:NHOMO 239 OP:NHOMOORG 227 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------122211122222----------1-11-1111------11--1-111--11-----1---------------1--1-1-1-----------------------------------1111-1111112111111111111-11111111--11112111111-11-11111111-------111-11---------------------------------------------1111111-------111--1---11-111111-1111-1--1--1-----------1-111-121111111111-111111111111111111111111--11-1111111111111111111111-----------------1-----1111--1--111----11111--1--------211111111111111111111--------------11111-----11----------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19,176-189| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcEEEEEEEcccHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHccccccccccc //