[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37740.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->64 PF11162 * DUF2946 0.00035 25.9 54/122  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37740.1 GT:GENE ABE37740.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 575878..576198 GB:FROM 575878 GB:TO 576198 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37740.1 GB:DB_XREF GI:91681438 LENGTH 106 SQ:AASEQ MRTWIGAAIIAAALGVMSPVAAQVPMPAAASATRAGESMPTEFSSRHRSRHAHRELRRSAHRHHARGPRPGYYATHYYARPYDYRPYGMAPFFPFGFGGYGFQPSW GT:EXON 1|1-106:0| TM:NTM 1 TM:REGION 6->28| SEG 7->13|aaiiaaa| SEG 16->32|vmspvaaqvpmpaaasa| SEG 44->66|ssrhrsrhahrelrrsahrhhar| SEG 86->104|pygmapffpfgfggygfqp| HM:PFM:NREP 1 HM:PFM:REP 7->64|PF11162|0.00035|25.9|54/122|DUF2946| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,31-66,105-107| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccccccccccccccccccccccc //