[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37741.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:233 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37741.1 GT:GENE ABE37741.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 576327..577028 GB:FROM 576327 GB:TO 577028 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37741.1 GB:DB_XREF GI:91681439 LENGTH 233 SQ:AASEQ MAAYAMAITPRRSHPPALASRVGLFAVAAVAALAMSIATAPRAQALSPASAGAATANKATANNTATERLIQVRAGHIGGGGGGGHHGGGGFHGGGGFRGGGFHHGGGFRGGGFRPAFHGGGYRGVGHIGRGPVFHHRQFYGGPRFVGHRHFGHRHFGHRYPGFRPYYGGARYYGYSRPRYYAPVYYGPRRVCRVIYTYYGPRRVCQFRPWRHHLHRHHWRHHHRHHRAWRVYW GT:EXON 1|1-233:0| TM:NTM 1 TM:REGION 17->39| SEG 26->40|avaavaalamsiata| SEG 43->66|aqalspasagaatankatanntat| SEG 75->131|ghiggggggghhggggfhggggfrgggfhhgggfrgggfrpafhgggyrgvghigrg| SEG 141->183|ggprfvghrhfghrhfghrypgfrpyyggaryygysrpryyap| SEG 208->230|rpwrhhlhrhhwrhhhrhhrawr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,6-6,47-58,227-227| PSIPRED cccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccHHHHHHHcccccccccccccccEEcccccccEEccccccHHHHHHHHHEcccccHHHcccHHHHHHHHHHHHHHHHHHccEEEcc //