[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37753.1
DDBJ      :             MiaB-like tRNA modifying enzyme
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  790/915 : Eukaryota  102/199 : Viruses  0/175   --->[See Alignment]
c.1.28c.92.1
:443 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   144->337 2qgqA PDBj 3e-10 31.0 %
:RPS:PDB   5->277 3cl5A PDBj 6e-35 8.4 %
:RPS:PDB   262->348 3dcxA PDBj 1e-17 8.1 %
:RPS:SCOP  120->345 1qgoA  c.92.1.2 * 2e-27 14.1 %
:HMM:SCOP  127->367 1oltA_ c.1.28.2 * 4.4e-51 30.7 %
:RPS:PFM   7->74 PF00919 * UPF0004 8e-06 33.8 %
:RPS:PFM   150->311 PF04055 * Radical_SAM 8e-10 32.2 %
:HMM:PFM   148->321 PF04055 * Radical_SAM 4e-24 28.6 161/166  
:HMM:PFM   3->89 PF00919 * UPF0004 1.7e-19 35.6 87/98  
:BLT:SWISS 4->400 Y416_RICPR e-105 49.0 %
:PROS 148->168|PS01278|MTTASE_RADICAL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37753.1 GT:GENE ABE37753.1 GT:PRODUCT MiaB-like tRNA modifying enzyme GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 587134..588465 GB:FROM 587134 GB:TO 588465 GB:DIRECTION + GB:PRODUCT MiaB-like tRNA modifying enzyme GB:PROTEIN_ID ABE37753.1 GB:DB_XREF GI:91681451 InterPro:IPR005839 InterPro:IPR006467 InterPro:IPR006638 InterPro:IPR007197 LENGTH 443 SQ:AASEQ MAVEIVTFGCRLNAFESEVIRREAEGAGLHDAIVINSCAVTNEAVAQARQQIRKLKRERPGARIVVTGCAAQTEPATFAGMDEVDRVIGNDDKMRSEAWRAARIAFDADTAFGLGAEQKIAVADIMAVREMAPHLVDGYQSGLPRVFVQVQNGCDHRCTFCIIPFGRGNSRSVPIGAVVDQVRALTERGHAEIVLTGVDLTSYGADLPGTPKLGALVKKVLRHVPELQRLRISSIDSIEADRDLLDALAGEQRLMPHLHLSLQAGDDLILKRMKRRHLRDDAIAFCEEVRRLRPDIALGADLIAGFPTETEAMFRRSLDLVDDCGLTFLHVFPYSKRPGTPAARMPQLDGRIIRERAARLRAAGEAALQRRLQAEIGQTRAVLIESATQGRTEHFIPVAMSGATPGTVQSLTIAGHDGARLTTTRRSSHTPQAAGADAAAAAR GT:EXON 1|1-443:0| BL:SWS:NREP 1 BL:SWS:REP 4->400|Y416_RICPR|e-105|49.0|382/421| PROS 148->168|PS01278|MTTASE_RADICAL|PDOC00984| SEG 350->374|griireraarlraageaalqrrlqa| SEG 433->442|aagadaaaaa| BL:PDB:NREP 1 BL:PDB:REP 144->337|2qgqA|3e-10|31.0|168/266| RP:PDB:NREP 2 RP:PDB:REP 5->277|3cl5A|6e-35|8.4|263/358| RP:PDB:REP 262->348|3dcxA|1e-17|8.1|86/114| RP:PFM:NREP 2 RP:PFM:REP 7->74|PF00919|8e-06|33.8|68/97|UPF0004| RP:PFM:REP 150->311|PF04055|8e-10|32.2|149/164|Radical_SAM| HM:PFM:NREP 2 HM:PFM:REP 148->321|PF04055|4e-24|28.6|161/166|Radical_SAM| HM:PFM:REP 3->89|PF00919|1.7e-19|35.6|87/98|UPF0004| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF00919|IPR013848| GO:PFM GO:0009451|"GO:RNA modification"|PF00919|IPR013848| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF00919|IPR013848| GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 120->345|1qgoA|2e-27|14.1|206/257|c.92.1.2| HM:SCP:REP 127->367|1oltA_|4.4e-51|30.7|231/0|c.1.28.2|1/1|Radical SAM enzymes| OP:NHOMO 1965 OP:NHOMOORG 959 OP:PATTERN 1111111111111111111111111111-111112111221211111121111211111111111111 2331311111111111111-111121111111111111112222211211111111111122222222222111111133331333333333233322233333333313-------22222223333333333332222222222222222222222222222222222222212222212222233333222222222222222222222222222222221-------3222222222222222222221----------------------------------------------------------------------33333333333333343333333333222332333333334333333321233212223323333332233333322222212222-33333333232122222222222223322333333333322222222222223331112222222222222222222222222213333321112222222222222222222222222121122222222222222222122122221111111222222333333323233323333344334223222332333333333323323232333233222222222121122222111222212112111-1121211111122222112222222222-2222222222222222222222221122222222222222222122122221-111111111111---31111111113121122212221111211222222222222122221222211112111111121121211112222211122222222222211111133333333--------32-------------------2------3333333333222 1111112-1-11111----------------------------------------------------------------------------------------111-121462222-1121211322518M3-52511-14-1222212121142222111523212222-42523334T444442223-243342223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 349 STR:RPRED 78.8 SQ:SECSTR cTGGccccEEccEEEEEccTTcGGGcccccHHHHHHHHHHHHHHHHHHTTHEEEEEEEEccEEcEEcccEETTEEcccccTTcccccccEEEEEEEEEEEEEEEEGGGcccTEEEEcccEEETTEEEccEEEEEETTTccEEEEEccccccccccEEEEEEEEETTEEEEEEEEEEccEEEccEEEEEEEEcccccEEEEcccccTTcccccHHHHHccTTEEEEcccccccEEEETTEEEHHHHHHHGcccEEETTEEEcccccccccccccEEccccHHHHHHHHHHHHTTccEEEEEEccTTTccTccHHHHHHHHHHHHTTEEEEEEEcccccTTcGGGccccGG############################################################################################## DISOP:02AL 432-439,441-444| PSIPRED cEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccccEEEcccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccEEEEEcEEccEEEccHHHHHHHHHHHHHccccEEEEEEEccEEcccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHcccEEcccccccccccHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEcccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccEEEEcccccccEEEEEEEEEccccEEEEEEEccccccccccHHHccc //