[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37758.1
DDBJ      :             periplasmic protein thiol
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  457/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->194 1kngA PDBj 8e-64 77.1 %
:RPS:PDB   46->193 2ec4A PDBj 2e-24 11.2 %
:RPS:SCOP  61->195 1z5yE1  c.47.1.10 * 4e-37 35.6 %
:HMM:SCOP  43->192 1kngA_ c.47.1.10 * 4.8e-36 33.8 %
:RPS:PFM   48->176 PF08534 * Redoxin 1e-22 46.7 %
:HMM:PFM   50->185 PF08534 * Redoxin 2.4e-20 25.8 128/146  
:BLT:SWISS 10->194 CYCY_BRAJA 8e-80 74.6 %
:PROS 85->103|PS00194|THIOREDOXIN_1
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37758.1 GT:GENE ABE37758.1 GT:PRODUCT periplasmic protein thiol GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(591670..592269) GB:FROM 591670 GB:TO 592269 GB:DIRECTION - GB:PRODUCT periplasmic protein thiol GB:PROTEIN_ID ABE37758.1 GB:DB_XREF GI:91681456 InterPro:IPR004799 InterPro:IPR006662 InterPro:IPR006663 InterPro:IPR011594 LENGTH 199 SQ:AASEQ MSTPVPDAPSPKRRSLVVALPLLVFAGLAALFWFRLGDRDISRIPSALIGREAPSTTLPSLEGLTRDGVQVAGLDPALFRGKVSVVNVWASWCVPCHDEAPLLTALADDKRIQIVGINYKDKPDNARRFLGRYGNPFVAVGVDPNGRAAIEWGVYGVPETFVVGRDGRIAYKLVGPITPDNLDKLLKAEIGKALAAPQS GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 10->194|CYCY_BRAJA|8e-80|74.6|185/194| PROS 85->103|PS00194|THIOREDOXIN_1|PDOC00172| TM:NTM 1 TM:REGION 15->37| BL:PDB:NREP 1 BL:PDB:REP 51->194|1kngA|8e-64|77.1|144/144| RP:PDB:NREP 1 RP:PDB:REP 46->193|2ec4A|2e-24|11.2|143/171| RP:PFM:NREP 1 RP:PFM:REP 48->176|PF08534|1e-22|46.7|120/132|Redoxin| HM:PFM:NREP 1 HM:PFM:REP 50->185|PF08534|2.4e-20|25.8|128/146|Redoxin| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08534|IPR013740| RP:SCP:NREP 1 RP:SCP:REP 61->195|1z5yE1|4e-37|35.6|132/136|c.47.1.10| HM:SCP:REP 43->192|1kngA_|4.8e-36|33.8|142/144|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 726 OP:NHOMOORG 460 OP:PATTERN ------1-----------------------------------------------------------1- 32222----------------1----------1--1----21112-1-111-21511-11-1421-11111-----------------11-1--11---------1--3----------------2311-11222-23321---22-------------------------------------11223---22-3333334323343332111--3341421112------211-----------------------------------------------------------------------------------------1-1-1---------------111-11--2--1-11-1--1--1---1---312111111111111112111111111111111111-11112121112-211112211122221124221111113111111112221121111111111---------------------111111222-3111121-------------1-111333323321221222223--1322----1-------131212---------------112121--1-12-11--1--------------------------22-233312212222213122222211231---3223------11--1-11111111111-111111111111111111111111---2222222222222222111111111-111111111111---1-----1111421-2222222222222112-------1211311312111122221211---------12222111112222243333333342222-12----------------1-------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 88.4 SQ:SECSTR #######################EEETTEEEEEETTccEEcccccHHHHcccccccccccHHHHHHTTcEETTTcccTTTccEEEEEEEcccccHHHHHHHHTTTcHHHHHHHHHTEEEEEEEcccHHHHHHHHHHHHHHTcHHHHHHHHHcccTTccEEEEEcccccEEEEEcccccHHHHHHHHHHHHHHHHHcccc DISOP:02AL 1-10,195-200| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHcccccccccccccccccccccccccccHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHccccccEEEEcccHHHHHHcccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHHcccc //