[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37762.1
DDBJ      :             heme exporter protein CcmA
Swiss-Prot:CCMA_RHOPS   RecName: Full=Cytochrome c biogenesis ATP-binding export protein ccmA;         EC=3.6.3.41;AltName: Full=Heme exporter protein A;

Homologs  Archaea  68/68 : Bacteria  886/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:200 amino acids
:PSIPRED
:BLT:PDB   34->158 1q12A PDBj 6e-16 42.3 %
:RPS:PDB   3->63 2awnA PDBj 3e-07 24.6 %
:RPS:PDB   34->186 2ccgB PDBj 9e-25 15.7 %
:RPS:SCOP  10->192 1sgwA  c.37.1.12 * 2e-24 20.9 %
:HMM:SCOP  6->186 1ii8.1 c.37.1.12 * 1.7e-41 33.3 %
:RPS:PFM   42->155 PF00005 * ABC_tran 7e-13 42.1 %
:HMM:PFM   42->155 PF00005 * ABC_tran 5.8e-21 33.6 113/118  
:HMM:PFM   10->56 PF01078 * Mg_chelatase 7.7e-06 42.6 47/207  
:BLT:SWISS 1->200 CCMA_RHOPS e-103 100.0 %
:PROS 127->141|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37762.1 GT:GENE ABE37762.1 GT:PRODUCT heme exporter protein CcmA GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(594086..594688) GB:FROM 594086 GB:TO 594688 GB:DIRECTION - GB:PRODUCT heme exporter protein CcmA GB:PROTEIN_ID ABE37762.1 GB:DB_XREF GI:91681460 InterPro:IPR001687 InterPro:IPR003439 InterPro:IPR003593 InterPro:IPR005895 LENGTH 200 SQ:AASEQ MWLSGRGLRCVRGGREVFDGLGFEAAGGEALALVGHNGAGKTSLLRLIAGLLAPAAGTITFDGGEPDTPVAEQAHYLGHRDALKPSLSVTENLAFWREFLGGEPTDLPAAIEAVGLAHAAELPAAYLSAGQRRRLSIARLLVVRRPIWLLDEPTSALDVRGQEAFGRLMSDHLAGGGLIIAATHSPLGIAAREMRIGAAA GT:EXON 1|1-200:0| SW:ID CCMA_RHOPS SW:DE RecName: Full=Cytochrome c biogenesis ATP-binding export protein ccmA; EC=3.6.3.41;AltName: Full=Heme exporter protein A; SW:GN Name=ccmA; OrderedLocusNames=RPD_0524; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Cytochrome c-type biogenesis; Hydrolase; Membrane; Nucleotide-binding;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->200|CCMA_RHOPS|e-103|100.0|200/200| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0017004|"GO:cytochrome complex assembly"|Cytochrome c-type biogenesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 127->141|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 20->33|glgfeaaggealal| BL:PDB:NREP 1 BL:PDB:REP 34->158|1q12A|6e-16|42.3|123/367| RP:PDB:NREP 2 RP:PDB:REP 3->63|2awnA|3e-07|24.6|61/330| RP:PDB:REP 34->186|2ccgB|9e-25|15.7|153/199| RP:PFM:NREP 1 RP:PFM:REP 42->155|PF00005|7e-13|42.1|114/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 42->155|PF00005|5.8e-21|33.6|113/118|ABC_tran| HM:PFM:REP 10->56|PF01078|7.7e-06|42.6|47/207|Mg_chelatase| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 10->192|1sgwA|2e-24|20.9|182/200|c.37.1.12| HM:SCP:REP 6->186|1ii8.1|1.7e-41|33.3|180/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 15589 OP:NHOMOORG 1117 OP:PATTERN 88627966AAA8A9A7F389887FEDFJCHFE52754254743CE7EE7COIB57A8BD443549132 9FHAwGJLNNMCIFFEEAA-AM22HcAAAAABOSRSXoig9PFbMWIKMFF6RNMD8D--PWMNVMQjlhJGAAAOA9EAOHF21245554414331--15523599A86333333324433336D6479238687LIJMO555QFE6DFBADGJ99536484ECFMLQQ6283311163231CHC66DA3CEHOONOOJKMEMNMIMKLEKKCLNMJEKHM7GMEHIFGIcb97777767667776775477B998JM8783CII99RTB658BC687FEECGGFHKJCBBECCDGDEDGFFFEGGGGGGFFKEEGFFDDEDEC8HEGGGGIDG5C69JBB8555B9DB9VCLD7bZCBBEB6CHDACB533E7GKKK621122HB*r*ACMWXORNPSQRQNUPQSt-RQcNKXRSU*B1*yy**zw*****ob87AWSwVWZcdQO98999999NCD79GHM3322211121221211212112112121157B966JdWKVYdgfjgTWUWTddqtZUXYNZbi*OSXR3APPLTGMJLTOfVhsAIMCB49MFCCDDBDDEGCDIGCKTADAICBFGEFM5FGDDGCEDDDBACORDF4754122222122122111125232CAHJQ8LB85C6AE8BA969DA999AABBAD91-46DD7-1----YLbQEULLLKIMJHJJI-LLJJIJIJJKLJJKKKKKKbccYXHHCIIIHJIIKIJJGJGHHOEEFHIHH9-KKLMOLMLKOOO114634444AB9BD8NKHDCDDEA77978C78A5554525557MFMLJMIRNQJJKIIKRQT666665666AHGFIILJKKKOHGHDBEAAAABDC77671197773333-11-11--C14121-2---3111111--214-----787747F7964IB --11489-DB2-5862242132221223422-121121-11-122322342152564234341------------------111-----23121-1111111-----5C4EAEAHFH8674AHAPP4I5c*L2J9LAD63K98OA5DB62J72t6HC9P7HI9D8C3OCIg39A54264o41225747H2FD32MGGD5 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEEEEEccEEEEEEEccccccccEEEEEccccccHHHHHHHHHccccccccEEEEcccccccHHHccEEEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHcccHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEcc //