[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37767.1
DDBJ      :             protein of unknown function UPF0005
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  381/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
:263 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   85->227 PF01027 * UPF0005 1e-29 54.5 %
:HMM:PFM   32->261 PF01027 * UPF0005 4.1e-35 31.1 196/203  
:BLT:SWISS 25->243 Y147_RICPR 1e-47 50.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37767.1 GT:GENE ABE37767.1 GT:PRODUCT protein of unknown function UPF0005 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(600372..601163) GB:FROM 600372 GB:TO 601163 GB:DIRECTION - GB:PRODUCT protein of unknown function UPF0005 GB:PROTEIN_ID ABE37767.1 GB:DB_XREF GI:91681465 InterPro:IPR006214 LENGTH 263 SQ:AASEQ MSDLDRNYASPFGRAAGRVDSAAVDAGLRAYMLRIYNYMTIGLAITGLAALGVYMGAVTPNDVGAAGRIGNTYLTTFGVAMFASPLKWVFILAPLAMVFAISFGINRLKPATAQLLFWAFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTGMGSFLIMGLFGVVIASVVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGYASEGGEVAERAAITGALSLYLNFINLFTLLLQLLGQKE GT:EXON 1|1-263:0| BL:SWS:NREP 1 BL:SWS:REP 25->243|Y147_RICPR|1e-47|50.3|193/236| TM:NTM 6 TM:REGION 38->60| TM:REGION 79->101| TM:REGION 125->147| TM:REGION 168->190| TM:REGION 194->216| TM:REGION 239->261| SEG 244->259|lylnfinlftlllqll| RP:PFM:NREP 1 RP:PFM:REP 85->227|PF01027|1e-29|54.5|143/200|UPF0005| HM:PFM:NREP 1 HM:PFM:REP 32->261|PF01027|4.1e-35|31.1|196/203|UPF0005| OP:NHOMO 418 OP:NHOMOORG 390 OP:PATTERN -------------------------------------------------------------------- ----1------------------------------------------------------------------1111111------1---------11-------------111111111111111------1---11------------------------------1----------------111-------------------------------------------------------------------1-1111112121122111111-11111111111111111111111111111111111111111111111----1--------------------------------------------11---211411111112121111111111111111111-112112111211211222122211111112112222111111111111111111111111111111111111111111111111111211-------1---------------------1111-----1---------------------------------11111111111111111----1111-1---11-11111111-111111111111-211------1-11-1-----1----------1-----1--------11111111111111111-11111111111111111111111111111111111111-1-11111111111-111112111111111-11111-----------------------------------------------------------------------------------------------------11111111----------------------------------------- ---------------------------------------------------------------------------------------------------1------------1--11----1--11------------------------------------------------1-1---------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,9-22,228-229,262-264| PSIPRED ccccHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //