[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37776.1
DDBJ      :             PilT protein-like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:139 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  6->116 2fe1A1  c.120.1.1 * 7e-06 13.9 %
:HMM:SCOP  1->137 2h1cA1 c.120.1.1 * 4.6e-17 27.0 %
:HMM:PFM   6->120 PF01850 * PIN 1.1e-11 21.1 109/126  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37776.1 GT:GENE ABE37776.1 GT:PRODUCT PilT protein-like GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 610186..610605 GB:FROM 610186 GB:TO 610605 GB:DIRECTION + GB:PRODUCT PilT protein-like GB:PROTEIN_ID ABE37776.1 GB:DB_XREF GI:91681474 InterPro:IPR002716 LENGTH 139 SQ:AASEQ MSAEAMLDANVLVYAASTAAAEAAKARTATQLLKTGNVGISGQVMQEFYVTVTRKSPTPLSVDDALDWLDVFNELPCIPVDAALVRSGAEIAQRYQISYWDGAVLAAAHRLNATVLYSEDLSHDQTYGSVRVVNPFRAN GT:EXON 1|1-139:0| SEG 15->30|aastaaaeaakartat| HM:PFM:NREP 1 HM:PFM:REP 6->120|PF01850|1.1e-11|21.1|109/126|PIN| RP:SCP:NREP 1 RP:SCP:REP 6->116|2fe1A1|7e-06|13.9|108/130|c.120.1.1| HM:SCP:REP 1->137|2h1cA1|4.6e-17|27.0|126/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 15 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- 1-------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------2----2--11-------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,138-140| PSIPRED ccHHHEEEccEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHccccccHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHccccEEEEEcccccEEEEEEEEEcccccc //