[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37780.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->132 2nnnE PDBj 3e-07 30.9 %
:RPS:PDB   18->135 2a61A PDBj 1e-13 21.2 %
:RPS:SCOP  36->138 2ethA1  a.4.5.28 * 5e-16 27.2 %
:HMM:SCOP  1->134 1jgsA_ a.4.5.28 * 3.5e-22 35.3 %
:RPS:PFM   48->88 PF09397 * Ftsk_gamma 8e-04 41.5 %
:HMM:PFM   36->85 PF01047 * MarR 3e-10 34.0 50/59  
:BLT:SWISS 27->135 YFIV_BACSU 8e-09 30.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37780.1 GT:GENE ABE37780.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 613913..614425 GB:FROM 613913 GB:TO 614425 GB:DIRECTION + GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID ABE37780.1 GB:DB_XREF GI:91681478 InterPro:IPR000835 LENGTH 170 SQ:AASEQ MRKVGNMLGAVSIVLADEIWAAVNDTLETSGETAAALIMLGAHPGIPIKELGRALALSHSGAVRLVDRLEKEGVVRRKEGRDARTVLLHLTPAGTKLRRSVLKERARVLERALAVLSAEEVRVLGAYLDRMLRGLLTERRLGYRFCRMCEEECCVPHDCPVDAKWKELSE GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 27->135|YFIV_BACSU|8e-09|30.3|109/160| BL:PDB:NREP 1 BL:PDB:REP 35->132|2nnnE|3e-07|30.9|97/131| RP:PDB:NREP 1 RP:PDB:REP 18->135|2a61A|1e-13|21.2|118/142| RP:PFM:NREP 1 RP:PFM:REP 48->88|PF09397|8e-04|41.5|41/67|Ftsk_gamma| HM:PFM:NREP 1 HM:PFM:REP 36->85|PF01047|3e-10|34.0|50/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 36->138|2ethA1|5e-16|27.2|103/140|a.4.5.28| HM:SCP:REP 1->134|1jgsA_|3.5e-22|35.3|133/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 21 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------111---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------11----------------1--------------------1--1--1-------------------------1-------------------------------------------------2-----1---1--1------11------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 96.5 SQ:SECSTR #ccHHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHEccHHTTTTcccEEEEEEEccccccccccc##### DISOP:02AL 170-171| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHcccccccccccccccccccHHHHHHHHcc //