[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37784.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->131 PF01124 * MAPEG 8.8e-26 29.1 117/123  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37784.1 GT:GENE ABE37784.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 620210..620611 GB:FROM 620210 GB:TO 620611 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37784.1 GB:DB_XREF GI:91681482 LENGTH 133 SQ:AASEQ MQPMPIEITVLGWSVVLLIVQMFLASVPAMLELGGPYQAGPRDEGKVAQGRFAGRANRAFRNLLETYPAFVALALALAVTGKTGGYAATAAVIWLVARVLYAPLYIIEIPFARSLVWFVALLALIAMLIRLMS GT:EXON 1|1-133:0| TM:NTM 4 TM:REGION 9->31| TM:REGION 60->81| TM:REGION 87->109| TM:REGION 111->133| SEG 48->62|aqgrfagranrafrn| SEG 72->91|alalalavtgktggyaataa| SEG 120->132|allaliamlirlm| HM:PFM:NREP 1 HM:PFM:REP 11->131|PF01124|8.8e-26|29.1|117/123|MAPEG| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111-11---------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHc //