[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37789.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:193 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 21->119 NHAA_DESHY 3e-04 31.2 %
:TM
:REPEAT 2|5->47|115->159
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37789.1 GT:GENE ABE37789.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 623344..623925 GB:FROM 623344 GB:TO 623925 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37789.1 GB:DB_XREF GI:91681487 LENGTH 193 SQ:AASEQ MKSAGIVRKPDDIMKRRLLQPLWFILAVLFLIEAWLWEHLEPWVARIVAAIPLRELKAWTAERVEHLSPPMALIVFVVPLIPLYPFKLFALWLMATQHFIAGLIAFALAQFVGLGLIAFIFDVTKPKLMQMAWFVRAYQFVLTVKAKAREIVAPVMARIRVGLADLLRGDGSGWSARALRRIGALRRRIRAER GT:EXON 1|1-193:0| BL:SWS:NREP 1 BL:SWS:REP 21->119|NHAA_DESHY|3e-04|31.2|96/389| TM:NTM 3 TM:REGION 18->40| TM:REGION 68->90| TM:REGION 100->122| NREPEAT 1 REPEAT 2|5->47|115->159| SEG 176->192|aralrrigalrrrirae| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111------------------------------------1------------------------------------------------------------------------------------------------------1--------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,190-194| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcc //