[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37807.1
DDBJ      :             Iojap-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  757/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:210 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   100->200 2o5aB PDBj 8e-19 40.8 %
:RPS:SCOP  100->200 2id1A1  d.218.1.12 * 5e-38 38.6 %
:RPS:PFM   103->200 PF02410 * DUF143 4e-28 54.1 %
:HMM:PFM   103->200 PF02410 * DUF143 7.6e-32 46.9 98/100  
:HMM:PFM   4->83 PF07382 * HC2 3.8e-06 41.8 79/194  
:BLT:SWISS 106->201 YBEB_SHIFL 1e-20 35.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37807.1 GT:GENE ABE37807.1 GT:PRODUCT Iojap-related protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(643190..643822) GB:FROM 643190 GB:TO 643822 GB:DIRECTION - GB:PRODUCT Iojap-related protein GB:PROTEIN_ID ABE37807.1 GB:DB_XREF GI:91681505 InterPro:IPR004394 LENGTH 210 SQ:AASEQ MSKADLPKSVAEEIVPAKTVKAKTAKAKTATSKTAASKTAASKTAAASKTAAASKTSASKTPASKTPASKTAASKTAASRSAKAEATPPDAISTTHGTAEETLQLILSRLDDMKAEETVAIDLRGKSAMFDYVVVTSGRVNRHVGAISENVSKALKEAGISKIHVEGLTNCDWVLMDCGDVVLHVFRPEVREFYNIERLWTQGPQPAKTL GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 106->201|YBEB_SHIFL|1e-20|35.4|96/105| SEG 17->87|aktvkaktakaktatsktaasktaasktaaasktaaasktsasktpasktpasktaasktaasrsakaeat| BL:PDB:NREP 1 BL:PDB:REP 100->200|2o5aB|8e-19|40.8|98/104| RP:PFM:NREP 1 RP:PFM:REP 103->200|PF02410|4e-28|54.1|98/99|DUF143| HM:PFM:NREP 2 HM:PFM:REP 103->200|PF02410|7.6e-32|46.9|98/100|DUF143| HM:PFM:REP 4->83|PF07382|3.8e-06|41.8|79/194|HC2| RP:SCP:NREP 1 RP:SCP:REP 100->200|2id1A1|5e-38|38.6|101/120|d.218.1.12| OP:NHOMO 815 OP:NHOMOORG 807 OP:PATTERN -------------------------------------------------------------------- 1111-1-----111-------1--11-----111111111-----1-1111111111------1-1-1-1-111111111111111111111-1-----111111111-1111111111111111111111111111111111111111-111----111-11111111111111111111111----11111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111-1-11111111111111111111111111111111111111111111111------------11------1-11-11111111111-1-111111-11211111111-1111111111111111111111111-11111111111-11111111111111111111111111111111111-1111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111-11-1111111111111111111111-1111111111111111111111-111-11111----------11---1111111111-111111111111111111111--11111------11111111111111-11-1121111111111111111111111111111111111111111111111111-11111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1---1111------------------------------------111111-111111 ------------111----------------------------------------------------------------------------------------111---121----1--1111-11-1-141-1111-1-1-11--1---1-1--1111---11-1-1--2---11-----111-1--------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 48.1 SQ:SECSTR ###################################################################################################HHHHHHHHHHHHHTTcEEEEEEEGGGTTTcccEEEEEEEccHHHHHHHHHHHHHHHHHTTccccEEEcTTTTcEEEEEcccEEEEEEETTccTTTcTTTcc########## DISOP:02AL 1-8,25-99,208-211| PSIPRED ccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEcccccccccEEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccEEEEcccHHHHHHHHHHHHHHccccccccc //