[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37838.1
DDBJ      :             ATP-binding region, ATPase-like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  171/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.26.1a.30.2d.122.1
:449 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   231->439 3d36B PDBj 3e-09 24.9 %
:RPS:PDB   221->441 3d36B PDBj 5e-15 19.3 %
:RPS:SCOP  205->287 1csgA  a.26.1.2 * 1e-04 12.5 %
:RPS:SCOP  300->440 1id0A  d.122.1.3 * 6e-12 15.6 %
:HMM:SCOP  209->297 2c2aA1 a.30.2.1 * 6.6e-06 20.2 %
:HMM:SCOP  292->445 1gkzA2 d.122.1.4 * 2.1e-24 28.6 %
:RPS:PFM   341->439 PF02518 * HATPase_c 2e-04 26.3 %
:HMM:PFM   340->439 PF02518 * HATPase_c 4.6e-21 34.0 100/111  
:HMM:PFM   228->287 PF00512 * HisKA 5e-08 28.8 59/68  
:BLT:SWISS 33->394 REGB_RHOS4 1e-15 26.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37838.1 GT:GENE ABE37838.1 GT:PRODUCT ATP-binding region, ATPase-like GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 677907..679256 GB:FROM 677907 GB:TO 679256 GB:DIRECTION + GB:PRODUCT ATP-binding region, ATPase-like GB:PROTEIN_ID ABE37838.1 GB:DB_XREF GI:91681536 InterPro:IPR003594 InterPro:IPR003661 InterPro:IPR004358 InterPro:IPR005467 LENGTH 449 SQ:AASEQ MQDKTAPARLRPRLGDDVTLSPAASSPADDATDRKNMSLLIQLRWTAVIGQIVTIGAVHLWLGAPLPVVPMGAVVLGLIALNIGSLAWMRYRVAVSNRDLLIALILDVVALTAQLYLSGGITNPFTSLYLLQVTLGAVLLDSRASWSLVAVVFAAFIWLTGASRPLVLPQTAGDPVNLTVAGMLIGFALNAVLLVVFVTRIHRNLRERDAHLAALRQHAAEQDHIVRMGLLASGAAHELGTPLASVSVILSDWRRMPALTENRELAEDLTEMETSLKRCQSIVTGILVSAGEARGEGSSPTTVAEFLSAIAEEWRNARCKTTLHVVNVFGEDLPIVSDVTLKQAIFNVLDNAFEVSRHWIELVAERDGDDLVLSIIDRGPGFSKDMLTQIGKPYQSSKGRVGGGLGLFLVMNVVRKLGGSMTAENLHNRGAKVKLVLPLKTLAIGDDFD GT:EXON 1|1-449:0| BL:SWS:NREP 1 BL:SWS:REP 33->394|REGB_RHOS4|1e-15|26.3|353/462| TM:NTM 6 TM:REGION 41->63| TM:REGION 67->89| TM:REGION 94->116| TM:REGION 121->143| TM:REGION 145->167| TM:REGION 175->197| SEG 21->31|spaasspadda| SEG 99->111|dllialildvval| SEG 187->198|falnavllvvfv| SEG 399->414|grvggglglflvmnvv| BL:PDB:NREP 1 BL:PDB:REP 231->439|3d36B|3e-09|24.9|201/221| RP:PDB:NREP 1 RP:PDB:REP 221->441|3d36B|5e-15|19.3|218/221| RP:PFM:NREP 1 RP:PFM:REP 341->439|PF02518|2e-04|26.3|99/112|HATPase_c| HM:PFM:NREP 2 HM:PFM:REP 340->439|PF02518|4.6e-21|34.0|100/111|HATPase_c| HM:PFM:REP 228->287|PF00512|5e-08|28.8|59/68|HisKA| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 2 RP:SCP:REP 205->287|1csgA|1e-04|12.5|80/120|a.26.1.2| RP:SCP:REP 300->440|1id0A|6e-12|15.6|141/146|d.122.1.3| HM:SCP:REP 209->297|2c2aA1|6.6e-06|20.2|89/0|a.30.2.1|1/1|Homodimeric domain of signal transducing histidine kinase| HM:SCP:REP 292->445|1gkzA2|2.1e-24|28.6|154/193|d.122.1.4|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 204 OP:NHOMOORG 171 OP:PATTERN -------------------------------------------------------------------- 11---------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------1-------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------1--11------112322111132211111111111-11111-11-31-1111221112112211-11-1111-1-------------1-1------------------------------1---1------1111111122222112222111111111--11-111111---1-112111111-------11-1-11-2-----1-1--1----1-----12214----------------------------11-----1------1111--11--111111-1----12---------------------------------------------------------------------------------------------1---------1111--------------------------1111111--------1-----------------------------1-1--1111111--1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 54.1 SQ:SECSTR ######################################################################################################################################################################################################HHHHHHcccHHHHHHHHHHHHHTTcEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccHHTTHHHHHHHHHHHHHHHHHHHHHHHHcccccHcccccEEEEHHHHHHHHHHHHHHHHHHTTEEEEEEccccEEEEcHHHHHHHHHHHHHHHHHTcTEEEEEEEEEETTEEEEEEEEccccccHHHHHHTTcTTccccGGGccccHHHHHHHHHHHTTcEEEEEEETTTEEEEEEEEEccc######## DISOP:02AL 1-9,23-31,211-224,259-262,290-300,440-450| PSIPRED cccccccccccccccccEEEccccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccEEEEEccccccEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEEEccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccccccccccc //