[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37847.1
DDBJ      :             TRAP dicarboxylate transporter- DctP subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  178/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.29.13
:341 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->330 2pfyA PDBj 3e-13 25.6 %
:RPS:PDB   27->331 2cexC PDBj 1e-19 18.6 %
:RPS:SCOP  221->266 3d19A2  a.29.13.1 * 7e-04 6.5 %
:RPS:PFM   51->316 PF03480 * SBP_bac_7 6e-22 31.8 %
:HMM:PFM   40->310 PF03480 * SBP_bac_7 6.2e-40 23.2 267/286  
:BLT:SWISS 53->317 DCTP_RHOCA 4e-14 27.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37847.1 GT:GENE ABE37847.1 GT:PRODUCT TRAP dicarboxylate transporter- DctP subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 689010..690035 GB:FROM 689010 GB:TO 690035 GB:DIRECTION + GB:PRODUCT TRAP dicarboxylate transporter- DctP subunit GB:PROTEIN_ID ABE37847.1 GB:DB_XREF GI:91681545 InterPro:IPR004682 LENGTH 341 SQ:AASEQ MRRTLGLSVAVSLSVTMALTSAQALELKVADSFPAGHYLVRLMLKPWMDDVTKRTNGAVTFSYYPNQQMGKATDLLRLTQSGVVDIGYIAPSYASDKMPLSEVAQLPESFSTSCQGTLAYWKSAREGVLAQKEYAPNKIKLLMAVVLPPYQVFTVKNKIESISDIQGLKLRTTGGAQDLTLRALGAVPVRMSAPDAYESLARGTMDGVLFPADSIPSYGLDKLVKHATDGVSFGSFIVAYSISQAAWNKLPADVKAAMDEASEAIEPKVCADVDKEQAQTRKQLNDAGVAYDPIPDATKAQMKDRLKGVSVEWAAAIDARGKPASEALKEFESLLAASANK GT:EXON 1|1-341:0| BL:SWS:NREP 1 BL:SWS:REP 53->317|DCTP_RHOCA|4e-14|27.9|258/333| BL:PDB:NREP 1 BL:PDB:REP 34->330|2pfyA|3e-13|25.6|281/295| RP:PDB:NREP 1 RP:PDB:REP 27->331|2cexC|1e-19|18.6|295/300| RP:PFM:NREP 1 RP:PFM:REP 51->316|PF03480|6e-22|31.8|258/284|SBP_bac_7| HM:PFM:NREP 1 HM:PFM:REP 40->310|PF03480|6.2e-40|23.2|267/286|SBP_bac_7| GO:PFM:NREP 2 GO:PFM GO:0006810|"GO:transport"|PF03480|IPR018389| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03480|IPR018389| RP:SCP:NREP 1 RP:SCP:REP 221->266|3d19A2|7e-04|6.5|46/130|a.29.13.1| OP:NHOMO 374 OP:NHOMOORG 180 OP:PATTERN -------------------------------------------------------------------- -------1---1-------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------2111---------2--------1--------------------------------------------------------------------------------------------2----------------------------1--22-1-1---------1---------------456--141222--1---1-112-112115235----11---11-12232---4783154238--------1----4-1-----------------------------------2A845-----------1111-----1---4-32-211-512221-A23321-----12----------431-1811122--211--1311-11-----------11--------------------11------2-----311111------1----1-1-------------1---1-------111---------1-2---1-----1-----11-1-1111-1111-1-111------------------------------------2CD---3-3-11-1---1-------22-----------5----4---------------1-1111111114-----------------------------------------------------------------1-111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 308 STR:RPRED 90.3 SQ:SECSTR ##########################EEEEccccTTcHHHHHHHHHHHHHHHHHccccccEEEEcTTTTccHHHHHHHHHTTcccEEEEcGGGGGGTcGGGGGGGcTTTcccHHHHHHHHHTcHHHHHHHHHHHHTTcEEEEEEEEEEEEEEEEEccccccGGGTTTcEEEcccHHHHHHHHHTTcEEEcccGGGHHHHHHTTcccEEEEEHHHHHHTTGGGcccEEEEEEEEEEEEEEEEEEHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEEEEccccHHHHHTTHHHHHHHHHHHccTTTTTcHcTTTcTTc####### DISOP:02AL 1-1,339-342| PSIPRED cHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHcccEEEEEEcccHHccccHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHcccEEEEEEEEccEEEEEEccccccHHHHcccEEEcccHHHHHHHHHcccEEEEccHHHHHHHHHcccccEEEccHHHHHHcccHHHcccEEcccccccccEEEEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccc //