[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37851.1
DDBJ      :             acetyl-CoA hydrolase/transferase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  313/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
c.124.1
:415 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->411 2oasA PDBj 3e-50 39.2 %
:RPS:PDB   11->414 3eh7A PDBj 3e-41 35.1 %
:RPS:SCOP  198->410 2g39A2  c.124.1.2 * 4e-48 30.7 %
:HMM:SCOP  5->213 2g39A1 c.124.1.2 * 1.9e-17 27.1 %
:HMM:SCOP  176->417 2g39A2 c.124.1.2 * 2.9e-57 40.3 %
:RPS:PFM   6->165 PF02550 * AcetylCoA_hydro 5e-07 32.0 %
:RPS:PFM   293->381 PF04223 * CitF 9e-07 44.6 %
:HMM:PFM   283->381 PF04223 * CitF 2.7e-07 37.6 93/466  
:HMM:PFM   14->154 PF02550 * AcetylCoA_hydro 0.00029 22.0 141/198  
:HMM:PFM   186->223 PF00455 * DeoR 0.0004 34.2 38/157  
:BLT:SWISS 20->412 CAT2_CLOK5 1e-60 38.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37851.1 GT:GENE ABE37851.1 GT:PRODUCT acetyl-CoA hydrolase/transferase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 693181..694428 GB:FROM 693181 GB:TO 694428 GB:DIRECTION + GB:PRODUCT acetyl-CoA hydrolase/transferase GB:PROTEIN_ID ABE37851.1 GB:DB_XREF GI:91681549 InterPro:IPR003702 LENGTH 415 SQ:AASEQ MPVATSAIDFAGLIRAGDLVVCGQATAEPRTLTEALAEQSFGLPPFRLMVGPLFSDTFSRTDTSNISFLSYGVIGHARKLARAGRLDVVPSNYSAFCADFASGRHRADVVLVQLAVSADGRLSASLSRDYVIDAARRARLVIAEINPDAPFTCGAEWPDDVPIHLRIAARHPPLELPSDAPDEVSRRIAANAAALIADGSTLQFGVGKIPDAILSSLTHARHLGIHSGLINDAVVDLIARGVVTNACKGIDPGVTVTNQLIGTQRLYCFADRNKAVAMHPASYTHDHGVLSRINRLVAINSALQVGVDGSVNAETLNGVAIGAIGGQLDFVRGANASPGGRAIIALPAAAPDGSSRIVASVETVTTPRADVDAIVTEWGVAELRGCSLSERARRMIAIAAPQHRDRLTHQSKPMT GT:EXON 1|1-415:0| BL:SWS:NREP 1 BL:SWS:REP 20->412|CAT2_CLOK5|1e-60|38.0|389/429| SEG 188->197|iaanaaalia| BL:PDB:NREP 1 BL:PDB:REP 3->411|2oasA|3e-50|39.2|388/420| RP:PDB:NREP 1 RP:PDB:REP 11->414|3eh7A|3e-41|35.1|362/389| RP:PFM:NREP 2 RP:PFM:REP 6->165|PF02550|5e-07|32.0|153/193|AcetylCoA_hydro| RP:PFM:REP 293->381|PF04223|9e-07|44.6|83/463|CitF| HM:PFM:NREP 3 HM:PFM:REP 283->381|PF04223|2.7e-07|37.6|93/466|CitF| HM:PFM:REP 14->154|PF02550|0.00029|22.0|141/198|AcetylCoA_hydro| HM:PFM:REP 186->223|PF00455|0.0004|34.2|38/157|DeoR| GO:PFM:NREP 6 GO:PFM GO:0003824|"GO:catalytic activity"|PF02550|IPR003702| GO:PFM GO:0006084|"GO:acetyl-CoA metabolic process"|PF02550|IPR003702| GO:PFM GO:0005737|"GO:cytoplasm"|PF04223|IPR006472| GO:PFM GO:0006084|"GO:acetyl-CoA metabolic process"|PF04223|IPR006472| GO:PFM GO:0008814|"GO:citrate CoA-transferase activity"|PF04223|IPR006472| GO:PFM GO:0009346|"GO:citrate lyase complex"|PF04223|IPR006472| RP:SCP:NREP 1 RP:SCP:REP 198->410|2g39A2|4e-48|30.7|202/274|c.124.1.2| HM:SCP:REP 5->213|2g39A1|1.9e-17|27.1|199/0|c.124.1.2|1/1|NagB/RpiA/CoA transferase-like| HM:SCP:REP 176->417|2g39A2|2.9e-57|40.3|231/0|c.124.1.2|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 507 OP:NHOMOORG 370 OP:PATTERN -----------------------2------1----------------12------------------- -121-11211211113-----1--11-----11-1--113-211------------------12--1---------------------11111133---11-11-1-1-----------------11121111211---11---1-------------------1---------------------11------11111111-111111------11-1-121--------1---------------------------------------------------------------------------------------------1-1-------1-1-133-----1-1---13-3315-9112---1-11----1--------111---11111--11111111111-----------1-1111---1----1--2---11111-----------1----112-------------------------------11--1221-----2-1222211112222-12-32121--11--1-1111-4----1-----1-----------2216A21----------78626112-1111-145------------------------------13-1221-11111-11111111-111---------------------111-1----1-11-11--1111-111111---------121-11111-1-1--1-1----11--111111-11111--------------11-----------------111111111-3-22121112-12121222-------------1----------11-1-11---------1111--11----------1-----------1---------1---1-1---1----11 ------1-------1-1-------------11------------------1111--------111111111111-1111111111111----1-------1------1-3------------------------------------------------1---111221114222---------1-----1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 412 STR:RPRED 99.3 SQ:SECSTR ##EcccHHHHHTTccTTcEEEEccGGGccHHHHHHHHHcTTGccTTcccEEEEccccccccTTccGGGGGcTccEEEcccTTcccTTcccccGGGHHHHHTTcccEccEEEEEEcccTTcEEEcTTccTTHHHHHHHccEEEEEEETTcccccGcGGEEccEEEGEEEEcccccccccccccHHHHHHHHHHHHTccTTcEEEccccHHHHHHHHTTTTccccEEEccTEcHHHHHHHHTTccccTTccccTTcEEcccEEccHHHHHHHTTcTTEEEccHHHHTcHHHHHTTcccEEEEcccEEETTccEEcccTTccccccccTHHHHHHHHHHcTTcEEEEcccEETTTTEEcEccTTccEEEcTTTccEEEETTEEEEcTTccHHHHHHHHHTTccHHHHHHHHHHHHHH# DISOP:02AL 1-1,414-416| PSIPRED ccccccHHHHHHHcccccEEEEccHHccHHHHHHHHHHHHHHccccEEEEcccccccccHHHHcccEEccccccHHHHHHHHcccEEcccccHHHHHHHHHcccccccEEEEEEcccccccEEEcccccHHHHHHHHccEEEEEEcccccccccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHcccccccEEEHHHHHHHHHHHHcccccccccccccccEEHHccccHHHHHHHHHHccEEEEEEccccccHHHHHHcccEEEEEEEEEEEEEccEEEcccccEEEccccHHHHHHHHHHHcccccEEEEEEcccccccEEEEccccccccccccccEEEEccEEEEEccccHHHHHHHHHHHccccHHHHHHHHHHHHc //