[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37882.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->40 PF09723 * CxxC_CxxC_SSSS 1e-14 42.5 40/42  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37882.1 GT:GENE ABE37882.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(730592..730804) GB:FROM 730592 GB:TO 730804 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE37882.1 GB:DB_XREF GI:91681580 LENGTH 70 SQ:AASEQ MPIYGYVCNKCGHGFETLLYAHETAACPSCESTDLDQQLSLIAKPAKGGPDVPMCDGAGGCGRCSPDLCA GT:EXON 1|1-70:0| HM:PFM:NREP 1 HM:PFM:REP 1->40|PF09723|1e-14|42.5|40/42|CxxC_CxxC_SSSS| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-45| PSIPRED ccccEEEEccccHHHHHHHHccccccccccccHHHHHHHccccccccccccccccccccccccccccccc //