[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37895.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   61->85 PF06544 * DUF1115 0.00042 44.0 25/128  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37895.1 GT:GENE ABE37895.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 741649..742233 GB:FROM 741649 GB:TO 742233 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE37895.1 GB:DB_XREF GI:91681593 LENGTH 194 SQ:AASEQ MGNAADEGDGGDLTRNDSYRFYLITRDAAWSERDGKRHREHGGLIHGRQALRYLGRPFGALVNVITRAKVRRLARELELRGVCYDQPSHSRVTAVSIASMIETIDKVGAAPRQPQPQPQPKAPAADTPPRRAPVAAMVRRAIKSVATFLFPEWGQRASKYQPERHYMRGPGPKWREKQGQYAVVARSSSRSQHH GT:EXON 1|1-194:0| SEG 109->141|aaprqpqpqpqpkapaadtpprrapvaamvrra| HM:PFM:NREP 1 HM:PFM:REP 61->85|PF06544|0.00042|44.0|25/128|DUF1115| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,33-38,108-130,163-164,184-195| PSIPRED ccccccccccccccccccEEEEEEEccccccHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccEEcccccccEEHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccHHHccccEEEEEEcccccccc //