[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37905.1
DDBJ      :             PTS IIA-like nitrogen-regulatory protein PtsN
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  526/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.112.1
:148 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   21->146 1a6jB PDBj 3e-22 40.5 %
:RPS:PDB   3->146 2a0jA PDBj 6e-25 31.2 %
:RPS:SCOP  1->146 1a6jA  d.112.1.1 * 6e-24 34.9 %
:HMM:SCOP  1->146 1a6jA_ d.112.1.1 * 2.5e-31 34.9 %
:RPS:PFM   12->141 PF00359 * PTS_EIIA_2 1e-16 40.0 %
:HMM:PFM   6->145 PF00359 * PTS_EIIA_2 2e-29 29.0 138/142  
:BLT:SWISS 1->145 PTSN_PSEAE 3e-22 35.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37905.1 GT:GENE ABE37905.1 GT:PRODUCT PTS IIA-like nitrogen-regulatory protein PtsN GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 752792..753238 GB:FROM 752792 GB:TO 753238 GB:DIRECTION + GB:PRODUCT PTS IIA-like nitrogen-regulatory protein PtsN GB:PROTEIN_ID ABE37905.1 GB:DB_XREF GI:91681603 InterPro:IPR002178 LENGTH 148 SQ:AASEQ MKIADFLSPANVLFDLRGSDKSKLLADLSARAAAGVDLAPTQVAPYLIKREELGSTGIGEGVAIPHTRLPDLRRPFGLLAKLRTPVEFDAIDAQAVDIVFVLLLPAVADNAHLGEIALVARTFRSAETRERVRRAKDASQLYAAVSCA GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 1->145|PTSN_PSEAE|3e-22|35.9|145/154| TM:NTM 1 TM:REGION 90->112| BL:PDB:NREP 1 BL:PDB:REP 21->146|1a6jB|3e-22|40.5|126/157| RP:PDB:NREP 1 RP:PDB:REP 3->146|2a0jA|6e-25|31.2|144/146| RP:PFM:NREP 1 RP:PFM:REP 12->141|PF00359|1e-16|40.0|125/142|PTS_EIIA_2| HM:PFM:NREP 1 HM:PFM:REP 6->145|PF00359|2e-29|29.0|138/142|PTS_EIIA_2| GO:PFM:NREP 3 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00359|IPR002178| GO:PFM GO:0006810|"GO:transport"|PF00359|IPR002178| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00359|IPR002178| RP:SCP:NREP 1 RP:SCP:REP 1->146|1a6jA|6e-24|34.9|146/150|d.112.1.1| HM:SCP:REP 1->146|1a6jA_|2.5e-31|34.9|146/150|d.112.1.1|1/1|Phoshotransferase/anion transport protein| OP:NHOMO 570 OP:NHOMOORG 527 OP:PATTERN -------------------------------------------------------------------- ------------1--------------------------------------1-----------1-------------------------------------------------------------11121111111-------------------------------------------------------1-1111111111111111311112111211-1111111211-111111-11111111-111111-1121-21211--141111--1111111111111111111111111111111111111111---111-11-1-11111111-1-2---111---1-11------------11111121--1111111111121111122121111111111111-11111212111-211122122211111111111111111-------------111------------------------------1111111111112121111111112111111211111111111111111111111211---11111111111-112-211-111-11111-121-1121122121111-------------------------11111111111111111111111111111111---1112------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11----------1111111111111111111----------1111111211111111111----------111111111221111111111111-------1111111--------1------1------1-----11-----------1------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 98.6 SQ:SECSTR ccHHHHccGGGEEEEEccccHHHHHHHHHHHHccTTcccHHHHHHHHHHHHTTccccccccEEccEEEETTccccEEEEEEEEEEEccccTTcccEEEEEEEEEEcccHHHHHHHHHHHHHHHTcHHHHHHHHHcccHHHHHHHHc## PSIPRED ccHHHcccHHHEEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccEEccccccccccccEEEEEEEcccccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcc //