[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37910.1
DDBJ      :             multiple resistance and pH regulation protein F
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->84 PF04066 * MrpF_PhaF 4.3e-20 43.4 53/55  
:BLT:SWISS 2->89 PHAF_RHIME 5e-13 36.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37910.1 GT:GENE ABE37910.1 GT:PRODUCT multiple resistance and pH regulation protein F GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(756655..756924) GB:FROM 756655 GB:TO 756924 GB:DIRECTION - GB:PRODUCT multiple resistance and pH regulation protein F GB:PROTEIN_ID ABE37910.1 GB:DB_XREF GI:91681608 InterPro:IPR007208 LENGTH 89 SQ:AASEQ MIATACLIAVAAISVSMLMNLYRLGRGPDVLDRILALETLVVNAVGLVVVMGLWFNTSLYFEIALLIVTVGFLSTVAFCKYLLRGNVIE GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 2->89|PHAF_RHIME|5e-13|36.4|88/92| TM:NTM 3 TM:REGION 2->24| TM:REGION 31->53| TM:REGION 59->81| SEG 40->53|lvvnavglvvvmgl| HM:PFM:NREP 1 HM:PFM:REP 32->84|PF04066|4.3e-20|43.4|53/55|MrpF_PhaF| OP:NHOMO 77 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-------------------------11---1----1-----111112211--------------------------------------------------------1-------------------------1---------111------11111-----------1-11--------1--------------------------------------------------------1-11-11---------------------------------------------------------------------------------------------------------------------------------1111---------------1-1-111----11111-11-111111------------1--------------1111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 89-90| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //