[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37919.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37919.1 GT:GENE ABE37919.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 766525..766917 GB:FROM 766525 GB:TO 766917 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37919.1 GB:DB_XREF GI:91681617 LENGTH 130 SQ:AASEQ MLQLKPVSCKPNWYGGSMRSSTMILLGSVALVAAFAVSDRVGGPRGVLIEPAVAATPVAPPVSAFRTVTSSSCSANGCPTTCEADEALISAICIGSSGAKFSDNLLVENGQITASCGPSSTAIVVSCARK GT:EXON 1|1-130:0| SEG 51->62|pavaatpvappv| OP:NHOMO 18 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------43344------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEcccccccccccccccEEEEcccccccccccccccccccEEEEEEEccccccEEEEEEEEccEEEEEEcccccEEEEEEEcc //