[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37932.1
DDBJ      :             Methenyltetrahydrofolate cyclohydrolase
Swiss-Prot:FOLD_RHOPS   RecName: Full=Bifunctional protein folD;Includes:  RecName: Full=Methylenetetrahydrofolate dehydrogenase;           EC=1.5.1.5;Includes:  RecName: Full=Methenyltetrahydrofolate cyclohydrolase;           EC=3.5.4.9;

Homologs  Archaea  27/68 : Bacteria  887/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:295 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->288 1b0aA PDBj 9e-70 49.5 %
:RPS:PDB   3->284 1b0aA PDBj 2e-50 49.8 %
:RPS:SCOP  2->148 1edzA2  c.58.1.2 * 6e-42 25.7 %
:RPS:SCOP  123->288 1a4iA1  c.2.1.7 * 2e-17 51.6 %
:HMM:SCOP  1->122 1a4iA2 c.58.1.2 * 1.3e-43 53.3 %
:HMM:SCOP  123->289 1a4iA1 c.2.1.7 * 2.5e-45 40.7 %
:RPS:PFM   5->121 PF00763 * THF_DHG_CYH 3e-33 59.0 %
:RPS:PFM   125->288 PF02882 * THF_DHG_CYH_C 5e-46 61.6 %
:HMM:PFM   124->285 PF02882 * THF_DHG_CYH_C 9.1e-67 58.9 158/161  
:HMM:PFM   4->121 PF00763 * THF_DHG_CYH 5.4e-44 52.1 117/117  
:BLT:SWISS 1->295 FOLD_RHOPS e-167 100.0 %
:PROS 76->101|PS00766|THF_DHG_CYH_1
:REPEAT 2|35->154|159->288

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37932.1 GT:GENE ABE37932.1 GT:PRODUCT Methenyltetrahydrofolate cyclohydrolase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 777825..778712 GB:FROM 777825 GB:TO 778712 GB:DIRECTION + GB:PRODUCT Methenyltetrahydrofolate cyclohydrolase GB:PROTEIN_ID ABE37932.1 GB:DB_XREF GI:91681630 InterPro:IPR000672 LENGTH 295 SQ:AASEQ MTARIIDGKIISADLRGRVAAEVTRIKAEHGITPGLAVVLVGSDPASEVYVRSKHKQTQEAGMASFEHRLPADVAQADLLALIGQLNADPAVHGILVQLPLPKGLDSNAVIDAIDPAKDVDGLNPVNAGRLASGLFALTPCTPLGCIIMAKQVHASLEGMNAIVIGRSNLVGKPLVQLLLNENATVTIAHSRSRDLPALCRQADLVFAAVGKAEMVKGDWIKPGATVIDVGINRTPSPDGGKDKLVGDVAFHEAKDVAGAITPVPGGVGLMTVACLLVNTVRAASAIHGLPKPGV GT:EXON 1|1-295:0| SW:ID FOLD_RHOPS SW:DE RecName: Full=Bifunctional protein folD;Includes: RecName: Full=Methylenetetrahydrofolate dehydrogenase; EC=1.5.1.5;Includes: RecName: Full=Methenyltetrahydrofolate cyclohydrolase; EC=3.5.4.9; SW:GN Name=folD; OrderedLocusNames=RPD_0694; SW:KW Amino-acid biosynthesis; Complete proteome; Histidine biosynthesis;Hydrolase; Methionine biosynthesis; Multifunctional enzyme; NADP;One-carbon metabolism; Oxidoreductase; Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->295|FOLD_RHOPS|e-167|100.0|295/295| GO:SWS:NREP 9 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009086|"GO:methionine biosynthetic process"|Methionine biosynthesis| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| PROS 76->101|PS00766|THF_DHG_CYH_1|PDOC00616| NREPEAT 1 REPEAT 2|35->154|159->288| BL:PDB:NREP 1 BL:PDB:REP 3->288|1b0aA|9e-70|49.5|281/287| RP:PDB:NREP 1 RP:PDB:REP 3->284|1b0aA|2e-50|49.8|277/287| RP:PFM:NREP 2 RP:PFM:REP 5->121|PF00763|3e-33|59.0|117/118|THF_DHG_CYH| RP:PFM:REP 125->288|PF02882|5e-46|61.6|159/160|THF_DHG_CYH_C| HM:PFM:NREP 2 HM:PFM:REP 124->285|PF02882|9.1e-67|58.9|158/161|THF_DHG_CYH_C| HM:PFM:REP 4->121|PF00763|5.4e-44|52.1|117/117|THF_DHG_CYH| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF00763|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF00763|IPR000672| GO:PFM GO:0003824|"GO:catalytic activity"|PF02882|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF02882|IPR000672| RP:SCP:NREP 2 RP:SCP:REP 2->148|1edzA2|6e-42|25.7|144/146|c.58.1.2| RP:SCP:REP 123->288|1a4iA1|2e-17|51.6|157/160|c.2.1.7| HM:SCP:REP 1->122|1a4iA2|1.3e-43|53.3|122/125|c.58.1.2|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 123->289|1a4iA1|2.5e-45|40.7|167/170|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1607 OP:NHOMOORG 1101 OP:PATTERN ------------------11111-21111111-----------11-1111111--------111--11 1111211111111111111-11111111111111111222122111111111221111112221222211111111111112311111111111111--1111111111111111111111111111111111111111111121111111111111111111111111111111111111112211111121111111111111111111111111111111111111111211111111111111111111111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111211111111111111111111111111111111111111111111111-1-------1211311122211322111111121111313111111111111-11111111111111111111111111111111112311112211111111111111121111111111111111112111111111111111111111-1111111111111111111111111212122111111122111111111111111111111111111111111112111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111121111111111111112111111111111332211122211111111121111111111111111111111111111111111111111111111111----1-111-111---111111---1111111111111 ----332-311-12211-11122222222222212222222221111122332311211111333333233232333-3333333233-111111111113-1434-16245747553443443764E2Jc5-8563442624554432353354553333223242633D21121333Y2222163641431245433 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 288 STR:RPRED 97.6 SQ:SECSTR cccEEccHHHHHHHHHHHHHHHHHHHHHTTccccEEEEEEEcccHHHHHHHHHHHHHHHHHTcEEccEEEcTTccHHHHHHHHHHHHTcTTccEEEEcccccTTccHHHHHTTccTTTcTTcccHHHHHHHHTTccccccHHHHHHHHHHHHTTcccTTcEEEEEcccTTTHHHHHHHHHTTTcEEEEEccccccHHHHHHHccEEEEccccTTcccTTTccTTcEEEEcccEEcTcTTcTTccEEccccHHHHHHHccEEcccccccHHHHHHHHHHHHHHHHHHHH####### DISOP:02AL 292-292,294-296| PSIPRED ccEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHcccccccccccHHHHHHHHccccccccccHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHcccEEEEEEcccccHHHHHccccEEEEcccccccccHHHcccccEEEEccccccccccccccEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccc //