[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37949.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37949.1 GT:GENE ABE37949.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 798964..799482 GB:FROM 798964 GB:TO 799482 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37949.1 GB:DB_XREF GI:91681647 LENGTH 172 SQ:AASEQ MALIGRLFAIAFGFLFASLAAGLVIVGTMLFPELSDIAGAPIDPDALNIVLGFGFIFVSGFALLPALIVVLVTEAFAIRSALVYAIGGAAVGVACYLGLVPFDPATLQFDGIVRRHLEIMTGAGIIGGLVYWLIAGRNAGLWRDPPRRSLPHPGVPPAPQPPSPPSQIPPSP GT:EXON 1|1-172:0| TM:NTM 4 TM:REGION 6->28| TM:REGION 49->71| TM:REGION 86->108| TM:REGION 116->137| SEG 7->23|lfaiafgflfaslaagl| SEG 81->94|alvyaiggaavgva| SEG 151->171|phpgvppapqppsppsqipps| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,151-173| PSIPRED cHHHHHHHHHHHHHHHHHHcccEEHHHHHccHHHHHHcccccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccc //