[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37954.1
DDBJ      :             protein of unknown function DUF1674
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   52->73 2k5kA PDBj 6e-06 72.7 %
:HMM:PFM   31->73 PF07896 * DUF1674 7.7e-20 60.5 43/47  
:BLT:SWISS 52->73 CF057_MOUSE 3e-07 81.8 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37954.1 GT:GENE ABE37954.1 GT:PRODUCT protein of unknown function DUF1674 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(804487..804708) GB:FROM 804487 GB:TO 804708 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1674 GB:PROTEIN_ID ABE37954.1 GB:DB_XREF GI:91681652 InterPro:IPR012875 LENGTH 73 SQ:AASEQ MTKSDPQIEAAVPTKTPRKELPDAAKRALAEAEARRAEAAKHAAAHAKEYQGPKGPEPTRYGDWEVKGIASDF GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 52->73|CF057_MOUSE|3e-07|81.8|22/104| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 23->52| SEG 24->49|aakralaeaearraeaakhaaahake| BL:PDB:NREP 1 BL:PDB:REP 52->73|2k5kA|6e-06|72.7|22/62| HM:PFM:NREP 1 HM:PFM:REP 31->73|PF07896|7.7e-20|60.5|43/47|DUF1674| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-10,12-12,31-55,72-74| PSIPRED ccccccccEEcccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEccc //