[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37963.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   33->90 3cdxC PDBj 2e-04 17.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37963.1 GT:GENE ABE37963.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(816684..817019) GB:FROM 816684 GB:TO 817019 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37963.1 GB:DB_XREF GI:91681661 LENGTH 111 SQ:AASEQ MNKDDRKAAITAYKERKPKAAIYAIRCTAADALWVGPTLNPDSVQNRIWFTLRFGNHPNRDLQQAWTAHGADAFAIETLELFEPDADRYLRDNQLKDRAAHWRSKLDARPV GT:EXON 1|1-111:0| RP:PDB:NREP 1 RP:PDB:REP 33->90|3cdxC|2e-04|17.2|58/325| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- -1------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------1------------------------1111--------11-----1-----------------1---1--1-------------1----------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 52.3 SQ:SECSTR ################################EEEEccccHHHHHHTccccTTTcccGGGcTTccTTccHHHHHHHHHHHTTGGGccEEE##################### DISOP:02AL 1-5,8-10,110-112| PSIPRED ccHHHHHHHHHHHHHcccccEEEEEEEcccccEEEcccccHHHHHHHHHHHccccccccHHHHHHHHHcccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccc //