Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37976.1
DDBJ      :             conserved hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37976.1 GT:GENE ABE37976.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 828657..828863 GB:FROM 828657 GB:TO 828863 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37976.1 GB:DB_XREF GI:91681674 LENGTH 68 SQ:AASEQ MAMLTYEDHPIDALIGPAASVEQRAETAPDDDVEERWLQSLPLPRRLFARFYRALRKLQPMFPPMSCC GT:EXON 1|1-68:0| SEG 41->58|lplprrlfarfyralrkl| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,21-30| PSIPRED cccccccccccEEEEccccccHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccc //