[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38000.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->102 PF02870 * Methyltransf_1N 0.00044 29.9 67/77  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38000.1 GT:GENE ABE38000.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 853465..853887 GB:FROM 853465 GB:TO 853887 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE38000.1 GB:DB_XREF GI:91681698 LENGTH 140 SQ:AASEQ MPYTVTAVRKDEKMQSVRNSSLIALAKARVWESEGWKVLIADPEGREHDIAQLDELTAFKPGKMTALSAILPADEPLSAQRPASQSRVEEEAATEEEAAFHLEEVHGPWLAEPHGPWLAESYDSESYDSASRESLSLHSS GT:EXON 1|1-140:0| SEG 89->104|eeeaateeeaafhlee| SEG 118->139|laesydsesydsasreslslhs| HM:PFM:NREP 1 HM:PFM:REP 30->102|PF02870|0.00044|29.9|67/77|Methyltransf_1N| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,77-95,126-126,128-128,131-133,135-135,137-141| PSIPRED ccEEEEEEEcccHHHHHHccEEEEEEEEEEEcccccEEEEEccccccccHHHHHHHHHcccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccc //