[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38030.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 15->100 WTPB_METJA 8e-04 33.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38030.1 GT:GENE ABE38030.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(889091..889393) GB:FROM 889091 GB:TO 889393 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38030.1 GB:DB_XREF GI:91681728 LENGTH 100 SQ:AASEQ MRNDPRDLPATDDSLTRFLGGSPLAVFFRLALMSILVGVVLAAIGLDPWNILVSIRLLFQRIWDLGFDAISGVWRYFLLGAVIVIPIWLLTRLFGTPRGR GT:EXON 1|1-100:0| BL:SWS:NREP 1 BL:SWS:REP 15->100|WTPB_METJA|8e-04|33.7|83/100| TM:NTM 2 TM:REGION 23->45| TM:REGION 75->97| OP:NHOMO 34 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--11111111111111----------1-11-11-1-111-1--111-111--11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,98-101| PSIPRED ccccHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //