[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38044.1
DDBJ      :             signaling protein containing EAL domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  413/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.1.33
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->244 3gg0A PDBj 2e-31 32.9 %
:RPS:PDB   20->237 2basB PDBj 1e-26 21.0 %
:RPS:SCOP  22->252 2basA1  c.1.33.1 * 4e-36 22.1 %
:HMM:SCOP  9->236 2basA1 c.1.33.1 * 1.5e-50 34.1 %
:RPS:PFM   19->236 PF00563 * EAL 9e-29 34.3 %
:HMM:PFM   18->236 PF00563 * EAL 1.9e-52 37.1 213/236  
:BLT:SWISS 21->244 YCGF_ECOLI 4e-21 34.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38044.1 GT:GENE ABE38044.1 GT:PRODUCT signaling protein containing EAL domain GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(909296..910069) GB:FROM 909296 GB:TO 910069 GB:DIRECTION - GB:PRODUCT signaling protein containing EAL domain GB:PROTEIN_ID ABE38044.1 GB:DB_XREF GI:91681742 InterPro:IPR001633 LENGTH 257 SQ:AASEQ MSSVCTQCRNDLPLPFAMKMAFQPIVDLSAQRVWGYEALVRGPNGEPAGTVLSQVSEEIRYRFDQAARVLAIETAGTLFRDPNVRLSINFMPNAVYEPNACIQKSLAAAKRAGFPHRNLMFEFTENERMQDAAHLNKIIEAYRKLGFLTALDDFGAGFAGLGLLAKLQPDLIKIDMEVLRDIHLSRAKQVIVAGIVGIARELDVRVLAEGVECEQECTVLRAAGISLFQGYHFAKPALMALPEVPLLTPRIDVKAAG GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 21->244|YCGF_ECOLI|4e-21|34.2|222/403| SEG 150->165|alddfgagfaglglla| BL:PDB:NREP 1 BL:PDB:REP 19->244|3gg0A|2e-31|32.9|225/392| RP:PDB:NREP 1 RP:PDB:REP 20->237|2basB|1e-26|21.0|210/387| RP:PFM:NREP 1 RP:PFM:REP 19->236|PF00563|9e-29|34.3|213/236|EAL| HM:PFM:NREP 1 HM:PFM:REP 18->236|PF00563|1.9e-52|37.1|213/236|EAL| RP:SCP:NREP 1 RP:SCP:REP 22->252|2basA1|4e-36|22.1|226/257|c.1.33.1| HM:SCP:REP 9->236|2basA1|1.5e-50|34.1|226/0|c.1.33.1|1/1|EAL domain-like| OP:NHOMO 1618 OP:NHOMOORG 418 OP:PATTERN -------------------------------------------------------------------- 3--11----------------4----------1---1---2-225-------111-----12---11-------------2--23644------------------------------------------------122-1----1923422-1-33---1--423-212-------------1-1-----24-22222112-212221-1----2233211-14------21--------------------------2---------------------------------------------------------------31345-------1-1-722----2-1--2214-21311---1----2----1-4552------1E9B33265768--11-11-1-1-8785748A261-98869E8ABC8634443131342234---------7221-956------------------------------453513----44546431111449A33333234A2653--993446444-1821665567C66---------179A-2222244335665--4-2--151----2---71-1----------------74461113236745595F7454579554434455344---1648------3621-825445555555-3545554555355445454686-----3123333333333333321---21-----------------7-1-1-211-1-947-------------------------3633336646575655786---------62555999996766621433333331111--5-5511-1--------1---------------------------------1------ --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1-------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 100.0 SQ:SECSTR HHTTcccEEEEcccccTHHEEEEEEEETTTccEEEEEEEEEEEETTHHHHTcccccHHHHHHHHHHHHHHHHHHHHTccTcTTcEEEEccHHHHGGTTHHHHHHHHHHHHHHTccGGGEEEEEcTTTccccHHHHHHHHHHHHTTTcEEEEccTTcccccHHHHHHHcccEEEEEcTTTcccTTcTTHHHHHHHHHHHHHHHTcEEEEEccccHHHHHHHHTTTEEEEccTTTcccccccEEcEEEETccccHHHHH DISOP:02AL 1-1,252-258| PSIPRED cHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEEEccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHccHHHHHHHHHHHHHHHcccHHHEEEEEEHHHHHccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEcHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHccccEEEEccccccccHHHHHHHHcHHHHcccccc //