[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38046.1
DDBJ      :             glutathione S-transferase-like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  318/915 : Eukaryota  44/199 : Viruses  0/175   --->[See Alignment]
a.45.1c.47.1
:204 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->202 2gdrA PDBj 6e-64 56.9 %
:RPS:PDB   1->200 2dsaA PDBj 5e-39 57.5 %
:RPS:SCOP  1->77 1a0fA2  c.47.1.5 * 8e-33 66.2 %
:RPS:SCOP  82->200 1f2eA1  a.45.1.1 * 1e-29 43.7 %
:HMM:SCOP  1->85 1k0dD2 c.47.1.5 * 1.6e-18 44.0 %
:HMM:SCOP  80->201 1a0fA1 a.45.1.1 * 1e-30 35.5 %
:RPS:PFM   16->74 PF02798 * GST_N 1e-08 50.0 %
:RPS:PFM   137->188 PF00043 * GST_C 9e-05 40.4 %
:HMM:PFM   126->189 PF00043 * GST_C 9.9e-16 35.9 64/95  
:HMM:PFM   1->74 PF02798 * GST_N 1.3e-10 37.1 70/75  
:HMM:PFM   70->111 PF09109 * Xol-1_GHMP-like 0.00038 41.0 39/191  
:BLT:SWISS 1->203 GST_PROMI 3e-49 44.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38046.1 GT:GENE ABE38046.1 GT:PRODUCT glutathione S-transferase-like GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(912636..913250) GB:FROM 912636 GB:TO 913250 GB:DIRECTION - GB:PRODUCT glutathione S-transferase-like GB:PROTEIN_ID ABE38046.1 GB:DB_XREF GI:91681744 InterPro:IPR004045 InterPro:IPR004046 LENGTH 204 SQ:AASEQ MKLYYSPGACSLSPHIALSESGLPFELVKVDIRAKKLENGDDYTQINPKGSVPALGLDDGGVLTEGPAIVQMIADKVGGGKLAPENGTAERYRLQEWLNFISTDLHKSFGPLFSPVLGDEAKTFFKDRIAKYFAYADKQLAGKDYLMGSQFTVADGYLFVILTWADRMKIDMSTFANLAAFKARVAARPKVQDALRSEGLLQKT GT:EXON 1|1-204:0| BL:SWS:NREP 1 BL:SWS:REP 1->203|GST_PROMI|3e-49|44.3|203/203| BL:PDB:NREP 1 BL:PDB:REP 1->202|2gdrA|6e-64|56.9|202/202| RP:PDB:NREP 1 RP:PDB:REP 1->200|2dsaA|5e-39|57.5|200/200| RP:PFM:NREP 2 RP:PFM:REP 16->74|PF02798|1e-08|50.0|56/71|GST_N| RP:PFM:REP 137->188|PF00043|9e-05|40.4|52/98|GST_C| HM:PFM:NREP 3 HM:PFM:REP 126->189|PF00043|9.9e-16|35.9|64/95|GST_C| HM:PFM:REP 1->74|PF02798|1.3e-10|37.1|70/75|GST_N| HM:PFM:REP 70->111|PF09109|0.00038|41.0|39/191|Xol-1_GHMP-like| RP:SCP:NREP 2 RP:SCP:REP 1->77|1a0fA2|8e-33|66.2|77/80|c.47.1.5| RP:SCP:REP 82->200|1f2eA1|1e-29|43.7|119/121|a.45.1.1| HM:SCP:REP 1->85|1k0dD2|1.6e-18|44.0|84/102|c.47.1.5|1/1|Thioredoxin-like| HM:SCP:REP 80->201|1a0fA1|1e-30|35.5|121/121|a.45.1.1|1/1|Glutathione S-transferase (GST), C-terminal domain| OP:NHOMO 744 OP:NHOMOORG 362 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1---------------------------------------------------------------3-1----11--------1-12-111---------------------------------------------------------------------------------------1-----------------------1-------------------------------------------------------------------1-------------------------7448-----11ABA3312144211111111111-34422434133-222244467434352-1-34----13511111111111-11--------------------------------1333-1331677777723333558-233322A444251--12332432534181111----1---------1-21-1-----------------------11-126---------------------------222221412-21111111212111-1-11-21--1-11-------21111112221211112-222221121221222222223221121111111111111111132121111--11111-111111---------21112-11-1112-1-11111---11211211114-23322413-12---2-------------11--------2-144434331111111--1-------------------------------------------------------- ---------------31322--2312311-111111----1------112121211---111---------------------------3--11---------1---11-------------------------------------------------1-1------3--------2------------1-2--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 99.5 SQ:SECSTR cEEEEcTTcTTHHHHHHHHHHTcccEEEEEETTTTEETTcccGGGTcTTccccEEEcTTccEEEcHHHHHHHHHHHcGGGcccccTTcHHHHHHHHHHHHHHHHTHHHHGGGGcTTccHHHHHHHHHHHHHHHHHHHHHTcccccTTcccccHHHHHHHHHHHGGGTTTcccTTcHHHHHHHHHHHTcHHHHHHHHHTTcccT# DISOP:02AL 7-7,203-205| PSIPRED cEEEEccccHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHccccccccEEEEcccEEEEEHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHccHHHHHHHHHccHHHcc //