[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38047.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   93->133 3e6mD PDBj 9e-06 46.3 %
:RPS:PDB   39->136 3deuB PDBj 5e-10 21.9 %
:RPS:SCOP  42->148 2fbiA1  a.4.5.28 * 2e-13 23.1 %
:HMM:SCOP  31->175 2fbkA1 a.4.5.28 * 9.4e-21 25.9 %
:HMM:PFM   69->121 PF01047 * MarR 6e-08 27.5 51/59  
:BLT:SWISS 41->130 SLYA_SERP5 4e-05 34.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38047.1 GT:GENE ABE38047.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 913300..913869 GB:FROM 913300 GB:TO 913869 GB:DIRECTION + GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID ABE38047.1 GB:DB_XREF GI:91681745 InterPro:IPR000835 LENGTH 189 SQ:AASEQ MRLHGRVNIDAAAYSALHSRRTMDGAMKRKPSTEATAAWVRLMRVRSRVLDAVELDLKKAGFPPLAWYDALLELSRAPGGEMRPVELEKQMLIPQYSTSRLIDRLVDEGLAARRECEMDKRGLFVEITEAGRELQKTMWAAYSAAIEKHVGSKLSDADALRLCGLLDRLGCSCDGTAAAPPPRDTAAAR GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 41->130|SLYA_SERP5|4e-05|34.1|85/144| SEG 157->171|adalrlcglldrlgc| SEG 176->188|taaappprdtaaa| BL:PDB:NREP 1 BL:PDB:REP 93->133|3e6mD|9e-06|46.3|41/148| RP:PDB:NREP 1 RP:PDB:REP 39->136|3deuB|5e-10|21.9|96/130| HM:PFM:NREP 1 HM:PFM:REP 69->121|PF01047|6e-08|27.5|51/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 42->148|2fbiA1|2e-13|23.1|104/136|a.4.5.28| HM:SCP:REP 31->175|2fbkA1|9.4e-21|25.9|143/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 58 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1211-112-1---111------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111111---------------------1------111111111-------1-11--1-------------------------------------------------------2-1111-1--------------1-----------------------1--------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------111--------------------------------------------1111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 64.6 SQ:SECSTR ##########################cTccHHHHTTcHHHHHHHHHHHHHHHHHHHTGGGTccHHHHHHHHHHHHHTccccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEcccEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHH######################################### DISOP:02AL 1-4,6-7,13-34,182-190| PSIPRED ccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccHHHccc //