[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38049.1
DDBJ      :             N/apple PAN precursor protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->167 2f83A PDBj 1e-04 30.4 %
:HMM:PFM   45->88 PF00024 * PAN_1 5.7e-06 28.2 39/79  
:HMM:PFM   133->168 PF00024 * PAN_1 1.5e-05 25.8 31/79  
:HMM:PFM   86->97 PF09791 * Oxidored-like 0.001 63.6 11/48  
:BLT:SWISS 89->167 YL719_MIMIV 1e-05 31.9 %
:TM
:REPEAT 2|31->98|114->182
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38049.1 GT:GENE ABE38049.1 GT:PRODUCT N/apple PAN precursor protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 915473..916027 GB:FROM 915473 GB:TO 916027 GB:DIRECTION + GB:PRODUCT N/apple PAN precursor protein GB:PROTEIN_ID ABE38049.1 GB:DB_XREF GI:91681747 LENGTH 184 SQ:AASEQ MRRGGSVRAWLFVLALAAAALAPRVAQAQANFDRPGADYLRAKVSSNDPADCALMCERDRRCRSWTFAYPQAPEDGAFCWLKSSVPQRSPSNCCVSGVRGAGVLEPRNGSIEASIDRFGGDYRNFELKANEADDACKAACEQDNKCRAWTYARPGYVGRNARCFLKNQIKPPQRKPGFFSGVVR GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 89->167|YL719_MIMIV|1e-05|31.9|69/343| TM:NTM 1 TM:REGION 6->28| NREPEAT 1 REPEAT 2|31->98|114->182| SEG 8->30|rawlfvlalaaaalaprvaqaqa| BL:PDB:NREP 1 BL:PDB:REP 52->167|2f83A|1e-04|30.4|112/583| HM:PFM:NREP 3 HM:PFM:REP 45->88|PF00024|5.7e-06|28.2|39/79|PAN_1| HM:PFM:REP 133->168|PF00024|1.5e-05|25.8|31/79|PAN_1| HM:PFM:REP 86->97|PF09791|0.001|63.6|11/48|Oxidored-like| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -----------------------------------------------1-------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 60.9 SQ:SECSTR ###################################################HHHHHHHcccccEEEEEcccTTcccTEEEEEccGGGcccEEEEEEEEEEcccccccccccEEEEEEEcEEEEEEEcccHH###HHHHHHHTcccccEEEEEccccccTTE#EEEEE################# DISOP:02AL 1-5| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccccEEEEEcccccccccEEEEEccccccccccEEEEEEccccccccccccHHcccHHccccccccccccccHHHHHHHHHccccccEEEEEEcccccccccEEEEEccccccccccccEEcEEc //