[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38070.1
DDBJ      :             DSBA oxidoreductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  99/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:207 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->188 3fz5C PDBj 5e-13 27.3 %
:RPS:PDB   117->197 3bckA PDBj 1e-09 17.3 %
:RPS:SCOP  1->207 1r4wA  c.47.1.13 * 2e-35 18.9 %
:HMM:SCOP  1->208 1r4wA_ c.47.1.13 * 3.3e-43 25.6 %
:RPS:PFM   4->196 PF01323 * DSBA 5e-17 32.2 %
:HMM:PFM   4->197 PF01323 * DSBA 1.6e-38 27.2 191/193  
:BLT:SWISS 5->196 NAHD_PSEU8 1e-10 22.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38070.1 GT:GENE ABE38070.1 GT:PRODUCT DSBA oxidoreductase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 933919..934542 GB:FROM 933919 GB:TO 934542 GB:DIRECTION + GB:PRODUCT DSBA oxidoreductase GB:PROTEIN_ID ABE38070.1 GB:DB_XREF GI:91681768 InterPro:IPR001853 LENGTH 207 SQ:AASEQ MSRQIDYYFSFQSPWAYIGHQAFRRLVEAHDLAVNYKPVLLTGLFSETGGLPLAKRHPARQRYRLVELQRWREKRGLDFKLWPKHWPFDARLADGVVLAVVAAGLDPELYLQQAYAAVWERELDLADPAVLITLADDAGLPGEKLVAHAASDQTRDAYEQNRQDAMAADVFGSPAYVLDGEVFWGQDRIELLSDALKSGRGPYRPPR GT:EXON 1|1-207:0| BL:SWS:NREP 1 BL:SWS:REP 5->196|NAHD_PSEU8|1e-10|22.3|188/212| SEG 92->106|ladgvvlavvaagld| BL:PDB:NREP 1 BL:PDB:REP 5->188|3fz5C|5e-13|27.3|172/187| RP:PDB:NREP 1 RP:PDB:REP 117->197|3bckA|1e-09|17.3|81/164| RP:PFM:NREP 1 RP:PFM:REP 4->196|PF01323|5e-17|32.2|177/178|DSBA| HM:PFM:NREP 1 HM:PFM:REP 4->197|PF01323|1.6e-38|27.2|191/193|DSBA| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 1->207|1r4wA|2e-35|18.9|206/221|c.47.1.13| HM:SCP:REP 1->208|1r4wA_|3.3e-43|25.6|207/0|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 153 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111-------23411123333----------1-22-2211-1-4--11-1-11-1--221111121-11112--------1----111-----------------------------111-1--11-1111111-----111-------11-2533--22111---13223-111-----------------11------------------1---------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------1-----1111111-1-1-1----------------------------------------------------------------------------------------------------- ----------------1--1------------------------------------------------------------------------1-1-------1----1--1--------------------------------------------------------------11-------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 99.0 SQ:SECSTR ccEEEEEEEcTTcHHHHHHHHHHHHHHHHHTccEEEEEccccccccHHTcccGGGccHHHHHHHHHHHHHHHHTccTTcEEEEEEcccGGHHHHHHHHHHHHHTTcHHHHHHHHHHTcccTTcccccHHHHHHHHHHTcccHHHHHHHHHHHTcTTcHHHHHHHHHHTTcccccEEEETTEEcccTTcHHHHHHHHcHHHHHHHc## DISOP:02AL 203-208| PSIPRED ccccEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccHHccccHHHccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEEccEEEEcccHHHHHHHHHHHHHccccccc //